BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0386 (641 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC688.10 |rev3||DNA polymerase zeta catalytic subunit Rev3|Sch... 27 2.3 SPAC19B12.03 |bgs3||1,3-beta-glucan synthase subunit Bgs3|Schizo... 26 5.3 SPAC17D4.03c |||membrane transporter |Schizosaccharomyces pombe|... 25 7.0 >SPAC688.10 |rev3||DNA polymerase zeta catalytic subunit Rev3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1480 Score = 27.1 bits (57), Expect = 2.3 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +2 Query: 356 ILKKISNILYYIFNNDLFNASFYQTPYYN 442 IL+ N+L Y N + N QTPYYN Sbjct: 810 ILRGEVNLLNYSLENVVLNIFKKQTPYYN 838 >SPAC19B12.03 |bgs3||1,3-beta-glucan synthase subunit Bgs3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1826 Score = 25.8 bits (54), Expect = 5.3 Identities = 8/33 (24%), Positives = 19/33 (57%) Frame = +3 Query: 201 CFTFVFVITLCFDYPSVLILEMYILHVIIFLIN 299 C+ F+ +LC P L+ +Y+ +++F ++ Sbjct: 634 CYDFMIGASLCSHQPKFLLSLVYLTDLVLFFLD 666 >SPAC17D4.03c |||membrane transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 732 Score = 25.4 bits (53), Expect = 7.0 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -3 Query: 594 LYTTSLSLDKDALGWAFACPPVLV 523 L+T SL L DA+ AF C +LV Sbjct: 369 LWTNSLGLISDAIHMAFDCIAILV 392 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,248,159 Number of Sequences: 5004 Number of extensions: 41644 Number of successful extensions: 93 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 93 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 93 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 287744314 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -