BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0386 (641 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1572 - 34527730-34527859,34528077-34528136,34528253-345283... 27 9.6 >04_04_1572 - 34527730-34527859,34528077-34528136,34528253-34528375, 34528506-34528960,34529343-34529876,34530638-34531501 Length = 721 Score = 27.5 bits (58), Expect = 9.6 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -3 Query: 156 NE*IIKFLDLLTYYLKISVLNRSILLYTIFFFFKYIYASS 37 NE + F LLT+YL + +N L +++ F Y Y S Sbjct: 178 NEGVAIFALLLTFYLFVRAVNTGSLAWSLASAFGYFYMVS 217 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,734,635 Number of Sequences: 37544 Number of extensions: 205002 Number of successful extensions: 350 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 341 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 350 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1584867848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -