BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0385 (441 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 23 1.1 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 23 1.1 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 22 3.4 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 21 6.0 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 21 7.9 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 23.4 bits (48), Expect = 1.1 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = -3 Query: 355 NTVEDHQQDLEGQFDFVTIMRPQTMSSSCNTKVP 254 N V HQ E + +FV I P+ + T P Sbjct: 178 NDVVQHQSGSEAEAEFVCIATPEAIELHFTTDHP 211 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 23.4 bits (48), Expect = 1.1 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 231 LLLCYSSLGTLVLQLELIVCGL 296 +LLCY LVL+ IVCG+ Sbjct: 702 ILLCYLVTFALVLRPTDIVCGI 723 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.8 bits (44), Expect = 3.4 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -2 Query: 434 EGLHQCPYTCDVA 396 E QCPYT D A Sbjct: 557 ESEEQCPYTVDAA 569 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 21.0 bits (42), Expect = 6.0 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +2 Query: 110 ASPIKHKIVVMNVIRFSYLHIAGLY 184 A+ + +V++ V+R YLH A Y Sbjct: 58 ATVFGNTLVILAVVRERYLHTATNY 82 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 20.6 bits (41), Expect = 7.9 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +3 Query: 204 PQQNWLHRFLLLCYSSLGTLV 266 P W+H +L L + L TL+ Sbjct: 538 PIHTWIHPWLPLLRNRLDTLI 558 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,388 Number of Sequences: 438 Number of extensions: 2269 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11450997 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -