BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0381 (595 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1687.09 |||conserved fungal protein|Schizosaccharomyces pomb... 26 4.8 SPBC1773.15 |||membrane transporter|Schizosaccharomyces pombe|ch... 25 8.3 >SPAC1687.09 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1379 Score = 25.8 bits (54), Expect = 4.8 Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +1 Query: 439 ALTAALHSSHVLLEIHEYPRPCKSK-AIPRPS 531 A+ AA+ + + +HE P P K+K +I +PS Sbjct: 1155 AVRAAMKADKIFPAVHENPPPLKTKQSIAKPS 1186 >SPBC1773.15 |||membrane transporter|Schizosaccharomyces pombe|chr 2|||Manual Length = 497 Score = 25.0 bits (52), Expect = 8.3 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = +1 Query: 370 PHIIIVGCSWQSSRGHVDSLFIKALT 447 P+I I+ C +S GH +F+ A++ Sbjct: 386 PYICILSCISSNSAGHTKKVFMSAVS 411 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,446,820 Number of Sequences: 5004 Number of extensions: 47634 Number of successful extensions: 103 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 103 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 258201856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -