BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0381 (595 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled ... 27 0.46 AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A... 25 2.4 >AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled receptor 4 protein. Length = 426 Score = 27.1 bits (57), Expect = 0.46 Identities = 14/47 (29%), Positives = 23/47 (48%) Frame = -3 Query: 389 PTMMMWGG*NEYTIYVCDLSEKDRELSTYQDSKIFTHLCEM*DYTHM 249 P M++ G YT+ +C++S + RE T + T D TH+ Sbjct: 255 PLMIISGA---YTVILCEISNRSREKETSDSNSTGTMRLRCNDLTHI 298 >AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A2 protein. Length = 496 Score = 24.6 bits (51), Expect = 2.4 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = +1 Query: 418 VDSLFIKALTAALHSSHVLLEIHEYPRPCKSKAIPRPSFAI 540 V SL ++ A ++ I +YP + +PRP AI Sbjct: 79 VRSLAVQLYPAGPERDGIMAYIEDYPAGAQEPELPRPRAAI 119 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 609,338 Number of Sequences: 2352 Number of extensions: 11824 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57188952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -