BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0381 (595 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL590703-1|CAH70239.1| 654|Homo sapiens serine active site cont... 29 9.4 AL135907-3|CAI42501.1| 162|Homo sapiens serine active site cont... 29 9.4 AL135907-1|CAI42499.1| 654|Homo sapiens serine active site cont... 29 9.4 AK027823-1|BAB55393.1| 654|Homo sapiens protein ( Homo sapiens ... 29 9.4 >AL590703-1|CAH70239.1| 654|Homo sapiens serine active site containing 1 protein. Length = 654 Score = 29.5 bits (63), Expect = 9.4 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +3 Query: 336 VANVNSIFILATPHHHSRLLLAEQSWSCRFLVY*SLD 446 + N I + PHH SR LAE S + R+L++ SL+ Sbjct: 521 INNTRGIIFYSVPHHGSR--LAEYSVNIRYLLFPSLE 555 >AL135907-3|CAI42501.1| 162|Homo sapiens serine active site containing 1 protein. Length = 162 Score = 29.5 bits (63), Expect = 9.4 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +3 Query: 336 VANVNSIFILATPHHHSRLLLAEQSWSCRFLVY*SLD 446 + N I + PHH SR LAE S + R+L++ SL+ Sbjct: 96 INNTRGIIFYSVPHHGSR--LAEYSVNIRYLLFPSLE 130 >AL135907-1|CAI42499.1| 654|Homo sapiens serine active site containing 1 protein. Length = 654 Score = 29.5 bits (63), Expect = 9.4 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +3 Query: 336 VANVNSIFILATPHHHSRLLLAEQSWSCRFLVY*SLD 446 + N I + PHH SR LAE S + R+L++ SL+ Sbjct: 521 INNTRGIIFYSVPHHGSR--LAEYSVNIRYLLFPSLE 555 >AK027823-1|BAB55393.1| 654|Homo sapiens protein ( Homo sapiens cDNA FLJ14917 fis, clone PLACE1007112. ). Length = 654 Score = 29.5 bits (63), Expect = 9.4 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +3 Query: 336 VANVNSIFILATPHHHSRLLLAEQSWSCRFLVY*SLD 446 + N I + PHH SR LAE S + R+L++ SL+ Sbjct: 521 INNTRGIIFYSVPHHGSR--LAEYSVNIRYLLFPSLE 555 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,176,654 Number of Sequences: 237096 Number of extensions: 1710772 Number of successful extensions: 2207 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2179 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2207 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 6268037466 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -