BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0381 (595 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT015273-1|AAT94502.1| 2064|Drosophila melanogaster LD20667p pro... 29 4.8 AE014134-16|AAF51561.2| 2064|Drosophila melanogaster CG11376-PA ... 29 4.8 >BT015273-1|AAT94502.1| 2064|Drosophila melanogaster LD20667p protein. Length = 2064 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/42 (33%), Positives = 25/42 (59%) Frame = +1 Query: 355 YSF*PPHIIIVGCSWQSSRGHVDSLFIKALTAALHSSHVLLE 480 YSF PP++ + G W + V S+ ++A+T A+H+ L+ Sbjct: 730 YSFIPPNVHLPGIKWLDNHRAVFSINVEAVT-AIHTLDSFLD 770 >AE014134-16|AAF51561.2| 2064|Drosophila melanogaster CG11376-PA protein. Length = 2064 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/42 (33%), Positives = 25/42 (59%) Frame = +1 Query: 355 YSF*PPHIIIVGCSWQSSRGHVDSLFIKALTAALHSSHVLLE 480 YSF PP++ + G W + V S+ ++A+T A+H+ L+ Sbjct: 730 YSFIPPNVHLPGIKWLDNHRAVFSINVEAVT-AIHTLDSFLD 770 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,683,221 Number of Sequences: 53049 Number of extensions: 504560 Number of successful extensions: 913 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 906 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 913 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2400202284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -