BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0375 (552 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17898| Best HMM Match : Entericidin (HMM E-Value=4.3) 29 2.5 >SB_17898| Best HMM Match : Entericidin (HMM E-Value=4.3) Length = 532 Score = 29.1 bits (62), Expect = 2.5 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 355 LAESEFPLNKCVPYFLFISSYSLVAYGVLWLR 450 L+ FP N+ +PYF S + YG+ +LR Sbjct: 167 LSGKNFPKNEIMPYFFASSHVNYARYGLYYLR 198 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,611,961 Number of Sequences: 59808 Number of extensions: 297108 Number of successful extensions: 465 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 446 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 465 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1276425465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -