BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0374 (338 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014298-846|AAF46127.2| 2893|Drosophila melanogaster CG15899-PB... 30 0.67 AE014134-1750|AAF52845.2| 1489|Drosophila melanogaster CG31755-P... 27 4.7 >AE014298-846|AAF46127.2| 2893|Drosophila melanogaster CG15899-PB protein. Length = 2893 Score = 30.3 bits (65), Expect = 0.67 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +3 Query: 114 FVFRRVMQNVAVNFLM*FFFLWLYVVLGIFVLATRF 221 FV R M NVAV F + F++++ +LG+ + +F Sbjct: 1057 FVMLRTMDNVAVFFSLLVLFIFIFSILGMNLFGCKF 1092 >AE014134-1750|AAF52845.2| 1489|Drosophila melanogaster CG31755-PA protein. Length = 1489 Score = 27.5 bits (58), Expect = 4.7 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 2/32 (6%) Frame = -3 Query: 219 NGSPKRRFLVLHITIKKKITLRN--LLLHFAL 130 N SP R LV ++K++ +RN LL+HF+L Sbjct: 785 NQSPNRLMLVDDSQVRKQLPVRNIQLLIHFSL 816 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,285,781 Number of Sequences: 53049 Number of extensions: 248056 Number of successful extensions: 469 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 463 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 469 length of database: 24,988,368 effective HSP length: 75 effective length of database: 21,009,693 effective search space used: 777358641 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -