BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0374 (338 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g30160.1 68417.m04289 villin, putative similar to villin 2 (... 27 4.2 At1g68380.1 68414.m07811 expressed protein contains Pfam profile... 27 4.2 >At4g30160.1 68417.m04289 villin, putative similar to villin 2 (VLN2) [Arabidopsis thaliana] GI:3415115, villin 3 (VLN3) [Arabidopsis thaliana] GI:3415117; contains Pfam profiles PF00626: Gelsolin repeat, PF02209: Villin headpiece domain Length = 974 Score = 26.6 bits (56), Expect = 4.2 Identities = 13/49 (26%), Positives = 21/49 (42%) Frame = -2 Query: 199 IPSTTYNHKKKNYIKKFTATFCITRLKTK*RAGSLLRGRATFTIHCWLL 53 +P T N + K Y T FC+ + + G L+ T C++L Sbjct: 237 LPRKTANDEDKTYNSDITRLFCVEKGQANPVEGDTLKREMLDTNKCYIL 285 >At1g68380.1 68414.m07811 expressed protein contains Pfam profile PF03267: Arabidopsis protein of unknown function, DUF266 Length = 392 Score = 26.6 bits (56), Expect = 4.2 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +3 Query: 150 NFLM*FFFLWLYVVLGIFV 206 N L+ FF LW+ V++GI V Sbjct: 27 NLLLYFFILWIGVIVGIIV 45 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,936,596 Number of Sequences: 28952 Number of extensions: 122046 Number of successful extensions: 216 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 215 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 216 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 399440640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -