BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0370 (446 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 22 3.0 AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 21 5.3 AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 21 7.0 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 20 9.3 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 21.8 bits (44), Expect = 3.0 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 11/70 (15%) Frame = -2 Query: 436 KIRINVISVTLTLLS*VTKILKTFWE-STLRSQY-NL*VLEV-------PERKFY--FYI 290 KI + I L++L+ VT FW+ R+ + NL +++ E K FY Sbjct: 80 KIFLFAIYTNLSILTTVTIFKSAFWDVDKWRTLFTNLQYIDINLQNKGKKESKLMKNFYF 139 Query: 289 W*ILKQTVVL 260 W +LKQ + L Sbjct: 140 WFVLKQVMFL 149 Score = 21.0 bits (42), Expect = 5.3 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 339 YCDRSVDSQNVFNIFVTY 392 +C + Q +F IFVTY Sbjct: 529 FCFGFITKQLIFMIFVTY 546 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 21.0 bits (42), Expect = 5.3 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 238 HY*DTQLTKLQSVLEFTIYKNKIYVQ 315 +Y T++ L+SVLE I +IY Q Sbjct: 114 NYAFTRIILLKSVLEIVIIDIEIYSQ 139 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 20.6 bits (41), Expect = 7.0 Identities = 9/33 (27%), Positives = 19/33 (57%) Frame = -2 Query: 307 KFYFYIW*ILKQTVVLLIVYLNSVIRSCKKIVI 209 K Y Y + I+ ++ +VY+ + +R +K+ I Sbjct: 41 KIYKYTYNIVAVSLTAYMVYITTNLRITQKLSI 73 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 20.2 bits (40), Expect = 9.3 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -1 Query: 404 NTTIVGNENIENVLGIYAAI 345 N + G EN++ VL IY+ + Sbjct: 202 NHLLSGTENLDLVLPIYSQL 221 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,757 Number of Sequences: 336 Number of extensions: 1625 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10090848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -