BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0370 (446 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1071 + 30585106-30585288,30585737-30585919 27 6.9 10_06_0006 - 9496990-9497592,9497695-9497802,9497884-9497997,949... 27 9.1 >04_04_1071 + 30585106-30585288,30585737-30585919 Length = 121 Score = 27.1 bits (57), Expect = 6.9 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 247 DTQLTKLQSVLEFTIYKNKIYVQAPQALRDCIVIA 351 +TQL L LE ++K++++ P+ + CI A Sbjct: 69 ETQLKNLAEKLETAGVRHKVWIEQPENIPTCIATA 103 >10_06_0006 - 9496990-9497592,9497695-9497802,9497884-9497997, 9498170-9498219,9498346-9498434,9498542-9498738, 9498877-9499038,9499337-9499455,9499579-9499666, 9499744-9499849,9499968-9500056,9500167-9500319, 9500434-9500526,9500625-9500691,9500811-9500923, 9501544-9501639,9501782-9501961 Length = 808 Score = 26.6 bits (56), Expect = 9.1 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = +3 Query: 228 DRITLLRYTINKTTVCF 278 D +T+ +YT+N T+ CF Sbjct: 365 DNVTVTKYTLNATSACF 381 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,144,847 Number of Sequences: 37544 Number of extensions: 118807 Number of successful extensions: 168 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 165 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 168 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 859680288 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -