BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0370 (446 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 22 3.5 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 21 4.6 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 21.8 bits (44), Expect = 3.5 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +1 Query: 256 LTKLQSVLEFTIYKNKIYVQAPQALRDCIVI 348 L K+ VLE T Y N Y+ A D I Sbjct: 229 LIKISDVLEETFYNNGDYIIRQGARGDTFFI 259 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 21.4 bits (43), Expect = 4.6 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -1 Query: 416 ICYFNTTIVGNENIENVLGIYAA 348 + YF+ T++G ++I+ YAA Sbjct: 62 VVYFHVTVMGLDSIDENSMTYAA 84 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,738 Number of Sequences: 438 Number of extensions: 1707 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11697255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -