BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0370 (446 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g20160.1 68415.m02357 E3 ubiquitin ligase SCF complex subunit... 28 3.3 >At2g20160.1 68415.m02357 E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 (At17), putative E3 ubiquitin ligase; similar to Skp1 homolog Skp1b GI:3068809, UIP2 GI:3719211 from [Arabidopsis thaliana] Length = 150 Score = 27.9 bits (59), Expect = 3.3 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = +3 Query: 339 YCDRSVDSQNVFNIFVTYDSS-VKVTDM-TLIRIL 437 YC + VD N FVT+D+ VK DM TL ++L Sbjct: 58 YCKKHVDDVEAKNEFVTWDAEFVKNIDMDTLFKLL 92 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,190,963 Number of Sequences: 28952 Number of extensions: 112135 Number of successful extensions: 173 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 172 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 173 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 722638680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -