BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0365 (533 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein ... 22 3.4 AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein ... 22 3.4 AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific pro... 22 3.4 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 22 3.4 >DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein 3 protein. Length = 130 Score = 22.2 bits (45), Expect = 3.4 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -1 Query: 146 VLPSW*TDYCHLHVDKVRELLQRCCQSLLEN 54 VLP C DK RE++++ + L+EN Sbjct: 67 VLPDALATDCKKCTDKQREVIKKVIKFLVEN 97 >AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein protein. Length = 130 Score = 22.2 bits (45), Expect = 3.4 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -1 Query: 146 VLPSW*TDYCHLHVDKVRELLQRCCQSLLEN 54 VLP C DK RE++++ + L+EN Sbjct: 67 VLPDALATDCKKCTDKQREVIKKVIKFLVEN 97 >AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific protein 3c precursor protein. Length = 130 Score = 22.2 bits (45), Expect = 3.4 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -1 Query: 146 VLPSW*TDYCHLHVDKVRELLQRCCQSLLEN 54 VLP C DK RE++++ + L+EN Sbjct: 67 VLPDALATDCKKCTDKQREVIKKVIKFLVEN 97 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 22.2 bits (45), Expect = 3.4 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -3 Query: 246 FPWHRWGILKY 214 F +H+WGIL Y Sbjct: 507 FSFHQWGILVY 517 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,922 Number of Sequences: 438 Number of extensions: 3353 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15090993 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -