BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0363 (513 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_45726| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_5000| Best HMM Match : EGF_CA (HMM E-Value=0) 27 9.1 SB_55657| Best HMM Match : EGF_CA (HMM E-Value=0) 27 9.1 SB_11402| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 >SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 27.5 bits (58), Expect = 6.9 Identities = 17/66 (25%), Positives = 34/66 (51%), Gaps = 2/66 (3%) Frame = -3 Query: 457 EPDIQHSPPRHAGVINVHP-FIVLVTQIVGDAFARFPVLIRKHAVALRRLNDDVFQVPR- 284 +PD+ +P H G++ P ++ L+ ++ FA +R A A R L + P+ Sbjct: 1309 DPDLDPNPSMHLGLMYTLPMYVALLGAVIVLYFAVLTCRVRSKAKAKRSLPVTKAKSPKL 1368 Query: 283 AGLRRR 266 +G+++R Sbjct: 1369 SGIQKR 1374 >SB_45726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.1 bits (57), Expect = 9.1 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = -1 Query: 231 GSKVVSWARPTVTSTASKSERIALLLLKH-SEKENIQNFT 115 G+K +SW + T A K ++AL L H K+ ++N T Sbjct: 67 GTKSLSWEQYQQTKAAPKPTKMALAFLDHIYTKDQLKNST 106 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 27.1 bits (57), Expect = 9.1 Identities = 12/19 (63%), Positives = 15/19 (78%), Gaps = 1/19 (5%) Frame = -3 Query: 55 LRKIRIIFF-LVPNSCSPG 2 +R IRI+F L+ NSCSPG Sbjct: 27 VRDIRILFLDLISNSCSPG 45 >SB_5000| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 1050 Score = 27.1 bits (57), Expect = 9.1 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = +2 Query: 350 GESCKCVPYYLCNKNNEGVDVNNASVTGWGV--LDVRFGEEDCQESVEICCTN 502 G CKC P Y+ + N V +S+ + D G DC + + CTN Sbjct: 439 GYKCKCRPGYISSNNGRICTVVTSSMNPLDINECDPILGSNDCGANTD--CTN 489 >SB_55657| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 868 Score = 27.1 bits (57), Expect = 9.1 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = +2 Query: 350 GESCKCVPYYLCNKNNEGVDVNNASVTGWGV--LDVRFGEEDCQESVEICCTN 502 G CKC P Y+ + N V +S+ + D G DC + + CTN Sbjct: 265 GYKCKCRPGYISSNNGRICTVVTSSMNPLDINECDPILGSNDCGANTD--CTN 315 >SB_11402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 753 Score = 27.1 bits (57), Expect = 9.1 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = -1 Query: 231 GSKVVSWARPTVTSTASKSERIALLLLKH-SEKENIQNFT 115 G+K +SW + T A K ++AL L H K+ ++N T Sbjct: 134 GTKSLSWKQYQQTKAAPKPTKMALAFLDHIYTKDQLKNST 173 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,863,392 Number of Sequences: 59808 Number of extensions: 326029 Number of successful extensions: 1195 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1089 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1193 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1136110413 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -