BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0363 (513 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF203335-1|AAF19830.1| 175|Anopheles gambiae immune-responsive ... 34 0.002 AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 23 4.6 AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering In... 23 8.0 >AF203335-1|AAF19830.1| 175|Anopheles gambiae immune-responsive serine protease-relatedprotein ISPR20 protein. Length = 175 Score = 34.3 bits (75), Expect = 0.002 Identities = 20/63 (31%), Positives = 28/63 (44%) Frame = +2 Query: 317 TESNSVFTDKNGESCKCVPYYLCNKNNEGVDVNNASVTGWGVLDVRFGEEDCQESVEICC 496 T S T GE CV Y C +GV S +G ++D+R +DC + + CC Sbjct: 2 TNSEQFCTTSKGEDGICVYQYQCT---DGV----VSHSGANIIDIRHPLDDCNDHLMQCC 54 Query: 497 TNP 505 P Sbjct: 55 AEP 57 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 23.4 bits (48), Expect = 4.6 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 111 LYYENLRP*LAHYHFFL 61 LY+ N+R +AHY F++ Sbjct: 191 LYFLNIRTSMAHYTFYV 207 >AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering Institute proto-oncogeneproduct protein. Length = 358 Score = 22.6 bits (46), Expect = 8.0 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +1 Query: 235 LASEHLRNAPHAGEARHGEPGR 300 LAS+H + HAGE G GR Sbjct: 58 LASQHHALSHHAGEPSGGGGGR 79 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 516,861 Number of Sequences: 2352 Number of extensions: 10621 Number of successful extensions: 18 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46514490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -