BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0362 (552 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81043-5|CAB02802.2| 278|Caenorhabditis elegans Hypothetical pr... 29 2.9 AF039041-1|AAP46271.1| 1067|Caenorhabditis elegans Laminin relat... 27 9.0 >Z81043-5|CAB02802.2| 278|Caenorhabditis elegans Hypothetical protein C29F3.6 protein. Length = 278 Score = 28.7 bits (61), Expect = 2.9 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +3 Query: 333 ICKVK-MNSSHQYVCLNSELPK*IASSLYYYYFC*ISF 443 ICK+ +S Y+ N + SSLY +YFC + F Sbjct: 33 ICKLSAFKNSFGYLSANQAFADALYSSLYLFYFCFMDF 70 >AF039041-1|AAP46271.1| 1067|Caenorhabditis elegans Laminin related. see also lmb-protein 1 protein. Length = 1067 Score = 27.1 bits (57), Expect = 9.0 Identities = 17/57 (29%), Positives = 26/57 (45%) Frame = -1 Query: 468 YDENLILMRKIFNKNSNSTVN*QFILVILNLNKHIDEKNSFLLCKFVNTGSVAMYGH 298 Y + + + KI N N T +L+ IDEK + + + V GS + YGH Sbjct: 224 YADEISTLLKITNLRFNFTKLHTLGDDLLDYRPEIDEKYYYAIYEIVVRGSCSCYGH 280 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,607,356 Number of Sequences: 27780 Number of extensions: 167463 Number of successful extensions: 377 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 371 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 377 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1123720628 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -