BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0360 (561 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0216 - 1700223-1700666,1700749-1700860,1701534-1701837,170... 32 0.36 >03_01_0216 - 1700223-1700666,1700749-1700860,1701534-1701837, 1702358-1702426,1702543-1702657,1702740-1702811, 1702918-1703016,1703148-1703219,1703394-1703465, 1704940-1705154,1705277-1705495,1705792-1707076, 1707270-1707398 Length = 1068 Score = 31.9 bits (69), Expect = 0.36 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +3 Query: 333 LNIQWTALREIFVQPWAVTD-DDDGTLSLKAFIV 431 L + W REI Q W ++D D+DG LSL+ F + Sbjct: 463 LFLSWRLPREILKQVWDLSDQDNDGMLSLREFCI 496 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,738,440 Number of Sequences: 37544 Number of extensions: 164414 Number of successful extensions: 269 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 266 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 269 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1281410928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -