BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0359 (626 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 24 3.4 DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfat... 24 4.5 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 24.2 bits (50), Expect = 3.4 Identities = 10/37 (27%), Positives = 23/37 (62%) Frame = -1 Query: 299 PSQVEANLIKILSFLIPCSANKLINLIAFAMLASLSN 189 P Q+E ++ +++ L P S +KL+N + + +S+ + Sbjct: 658 PKQIEEAVMNLITNLQPDSEDKLLNTMPASPASSIKS 694 >DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfatase precursor protein. Length = 525 Score = 23.8 bits (49), Expect = 4.5 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +2 Query: 476 RKTPGVVSVTKIYNYYKKFGYKTQVMGASF 565 R+T G + T + Y+K+ GY+T +G F Sbjct: 105 RQTSG--NYTTLPQYFKQHGYRTHSVGKVF 132 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 689,976 Number of Sequences: 2352 Number of extensions: 13966 Number of successful extensions: 23 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61050630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -