BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0357 (505 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1556.02c |sdh1||succinate dehydrogenase Sdh1|Schizosaccharom... 28 0.92 SPBC56F2.03 |||actin-like protein Arp10 |Schizosaccharomyces pom... 27 1.6 SPBC21C3.20c |git1||C2 domain protein Git1|Schizosaccharomyces p... 27 1.6 SPAC694.06c |mrc1||mediator of replication checkpoint 1 |Schizos... 25 4.9 SPAC23E2.02 |lsd2|swm2, saf140|histone demethylase SWIRM2 |Schiz... 25 6.5 SPCC417.08 |tef3||translation elongation factor eEF3|Schizosacch... 25 8.5 >SPAC1556.02c |sdh1||succinate dehydrogenase Sdh1|Schizosaccharomyces pombe|chr 1|||Manual Length = 641 Score = 27.9 bits (59), Expect = 0.92 Identities = 21/83 (25%), Positives = 33/83 (39%), Gaps = 4/83 (4%) Frame = +3 Query: 231 GVCSHRCLSGSGCAGRGRLMLSERRPRMQTDFKSAALQRVLRPIQGQPRCSERTE--GIS 404 G+ CL GC G G +L+ + R + A R + + E E G+ Sbjct: 292 GIYGAGCLITEGCRGEGGYLLNSKGERFMERYAPTAKDLASRDVVSRAMTVEIREGRGVG 351 Query: 405 LTVFETFLPLS--PVGLLLQQLP 467 +L LS P +L ++LP Sbjct: 352 PEKDHCYLQLSHLPAEILKERLP 374 >SPBC56F2.03 |||actin-like protein Arp10 |Schizosaccharomyces pombe|chr 2|||Manual Length = 380 Score = 27.1 bits (57), Expect = 1.6 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 245 SLPVWLWVCWPRKTHAIRTSTKDA 316 ++P+ LW+C P T + TST+DA Sbjct: 94 NVPITLWICAP-LTAILSTSTRDA 116 >SPBC21C3.20c |git1||C2 domain protein Git1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1098 Score = 27.1 bits (57), Expect = 1.6 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 149 KAVLSTYVKRTCYFFENS 202 KAV YV+R CY+ EN+ Sbjct: 271 KAVFDKYVERECYYSENA 288 >SPAC694.06c |mrc1||mediator of replication checkpoint 1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1019 Score = 25.4 bits (53), Expect = 4.9 Identities = 13/52 (25%), Positives = 26/52 (50%) Frame = -3 Query: 227 IFDAIYLVANSRKNNKCV*RMSKVLPLHTLAQKATSNNDSSR*KRPHKDNTL 72 + D +YL +S ++ + +VLP+ +K SN+ S + DN++ Sbjct: 901 VVDRVYLKKSSTRHTSDNNSLEEVLPIFPGVRKLVSNSQSEKIGDLSNDNSM 952 >SPAC23E2.02 |lsd2|swm2, saf140|histone demethylase SWIRM2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1273 Score = 25.0 bits (52), Expect = 6.5 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +3 Query: 204 H*INRIKYEGVCSHRCL 254 H I+R++ +GVC RCL Sbjct: 446 HAISRVEAQGVCVDRCL 462 >SPCC417.08 |tef3||translation elongation factor eEF3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1047 Score = 24.6 bits (51), Expect = 8.5 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -2 Query: 204 GEFSKK*QVRLTYVESTAFTHTGAEGD 124 GE + R+ YV AFTH G D Sbjct: 729 GEIYQHENCRIAYVAQAAFTHLGHHPD 755 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,905,800 Number of Sequences: 5004 Number of extensions: 38102 Number of successful extensions: 82 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 82 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 82 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 200198394 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -