BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0357 (505 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38764| Best HMM Match : CBM_14 (HMM E-Value=1.5e-10) 36 0.019 SB_19839| Best HMM Match : Ery_res_leader2 (HMM E-Value=9.9) 34 0.077 SB_27121| Best HMM Match : CBM_14 (HMM E-Value=5.8e-29) 33 0.13 SB_10903| Best HMM Match : Aldolase_II (HMM E-Value=9.1e-17) 28 5.0 SB_33499| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_51717| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 SB_48207| Best HMM Match : Peptidase_C5 (HMM E-Value=0.33) 27 8.8 SB_10450| Best HMM Match : Peptidase_C5 (HMM E-Value=1.1) 27 8.8 >SB_38764| Best HMM Match : CBM_14 (HMM E-Value=1.5e-10) Length = 155 Score = 35.9 bits (79), Expect = 0.019 Identities = 20/54 (37%), Positives = 30/54 (55%) Frame = +1 Query: 214 IASNMKVYALIVACLALGVLAEEDSCYQNVDQGCRRTLSLPHCSAYYGQFKDNH 375 ++S+MK L++AC ++ E+D C + D GC + L CS YY Q D H Sbjct: 46 MSSDMKSLVLLIACFSVARATEDDFCKER-DAGC--YVDLKDCSKYY-QCDDFH 95 >SB_19839| Best HMM Match : Ery_res_leader2 (HMM E-Value=9.9) Length = 117 Score = 33.9 bits (74), Expect = 0.077 Identities = 18/41 (43%), Positives = 24/41 (58%) Frame = +3 Query: 234 VCSHRCLSGSGCAGRGRLMLSERRPRMQTDFKSAALQRVLR 356 V SH LSG GC G+GR + E++ R +A LQ +LR Sbjct: 56 VWSHLHLSGGGC-GKGRHLPKEKQSRGSPPISAALLQHILR 95 >SB_27121| Best HMM Match : CBM_14 (HMM E-Value=5.8e-29) Length = 339 Score = 33.1 bits (72), Expect = 0.13 Identities = 19/50 (38%), Positives = 26/50 (52%) Frame = +1 Query: 226 MKVYALIVACLALGVLAEEDSCYQNVDQGCRRTLSLPHCSAYYGQFKDNH 375 MK L++AC ++ E+D C + D GC + L CS YY Q D H Sbjct: 1 MKSLVLLIACFSVARATEDDYCKER-DAGC--YVDLKDCSKYY-QCDDFH 46 >SB_10903| Best HMM Match : Aldolase_II (HMM E-Value=9.1e-17) Length = 280 Score = 27.9 bits (59), Expect = 5.0 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +3 Query: 225 YEGVCSHRCLSGSGCAGRGRLML 293 +EGVC+H + G G GR+ML Sbjct: 63 HEGVCNHLSMMAPGKHGTGRVML 85 >SB_33499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 486 Score = 27.5 bits (58), Expect = 6.6 Identities = 11/36 (30%), Positives = 23/36 (63%) Frame = +3 Query: 150 RQYFRHTSNALVIFSRIRH*INRIKYEGVCSHRCLS 257 R + RH ++ +F R+ H NR++Y+G ++ C++ Sbjct: 367 RSHVRHEAS---LFGRMNHYENRVEYKGFTANICIA 399 >SB_51717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 799 Score = 27.1 bits (57), Expect = 8.8 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -1 Query: 202 RILEKITSAFDVCRKYCLYTHWRRRR 125 R L+ + SA VC +YCLY W R R Sbjct: 100 RQLQALDSA--VCGQYCLYFLWHRAR 123 >SB_48207| Best HMM Match : Peptidase_C5 (HMM E-Value=0.33) Length = 184 Score = 27.1 bits (57), Expect = 8.8 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -1 Query: 202 RILEKITSAFDVCRKYCLYTHWRRRR 125 R L+ + SA VC +YCLY W R R Sbjct: 100 RQLQALDSA--VCGQYCLYFLWHRAR 123 >SB_10450| Best HMM Match : Peptidase_C5 (HMM E-Value=1.1) Length = 245 Score = 27.1 bits (57), Expect = 8.8 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -1 Query: 202 RILEKITSAFDVCRKYCLYTHWRRRR 125 R L+ + SA VC +YCLY W R R Sbjct: 100 RQLQALDSA--VCGQYCLYFLWHRAR 123 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,580,830 Number of Sequences: 59808 Number of extensions: 298035 Number of successful extensions: 703 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 629 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 703 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1099461690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -