BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0356 (515 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC006405-1|AAH06405.1| 123|Homo sapiens thioredoxin-like 5 prot... 92 9e-19 AJ344101-1|CAC51435.1| 123|Homo sapiens putative 42-9-9 protein... 92 9e-19 X77584-1|CAA54687.1| 105|Homo sapiens ATL-derived factor/thiore... 29 7.3 X54539-1|CAA38410.1| 105|Homo sapiens thioredoxin protein. 29 7.3 CR407665-1|CAG28593.1| 105|Homo sapiens TXN protein. 29 7.3 BC054866-1|AAH54866.1| 105|Homo sapiens thioredoxin protein. 29 7.3 BC003377-1|AAH03377.1| 105|Homo sapiens thioredoxin protein. 29 7.3 AY004872-1|AAF87085.1| 105|Homo sapiens thioredoxin protein. 29 7.3 AL158158-1|CAI14066.1| 105|Homo sapiens thioredoxin protein. 29 7.3 AF548001-1|AAN33187.1| 105|Homo sapiens thioredoxin protein. 29 7.3 AF313911-1|AAG34699.1| 105|Homo sapiens thioredoxin protein. 29 7.3 U49356-1|AAA90924.1| 2285|Homo sapiens DNA polymerase epsilon ca... 29 9.7 S60080-1|AAA15448.1| 2257|Homo sapiens DNA polymerase epsilon ca... 29 9.7 L09561-1|AAC19148.1| 2286|Homo sapiens DNA polymerase epsilon, c... 29 9.7 J04026-1|AAA74596.1| 105|Homo sapiens thioredoxin protein. 29 9.7 BC087613-1|AAH87613.1| 797|Homo sapiens POLE protein protein. 29 9.7 BC007599-1|AAH07599.1| 797|Homo sapiens Unknown (protein for IM... 29 9.7 AY273166-1|AAP12650.1| 2265|Homo sapiens polymerase (DNA directe... 29 9.7 AF276919-1|AAF86466.1| 105|Homo sapiens thioredoxin 1 protein. 29 9.7 AF127975-3|AAD44692.1| 2243|Homo sapiens DNA polymerase epsilon ... 29 9.7 AF127975-2|AAD44691.1| 2286|Homo sapiens DNA polymerase epsilon ... 29 9.7 AF127975-1|AAD44690.1| 2297|Homo sapiens DNA polymerase epsilon ... 29 9.7 >BC006405-1|AAH06405.1| 123|Homo sapiens thioredoxin-like 5 protein. Length = 123 Score = 92.3 bits (219), Expect = 9e-19 Identities = 44/95 (46%), Positives = 58/95 (61%), Gaps = 1/95 (1%) Frame = +2 Query: 233 VDLKGFEEFSKYTRAIDSR-GPPVFFYFSGSKLPDGNSWCPDCVEAEPVVRHYLSELDKS 409 V + GFEEF RA++ G +F YF+GSK G SWCPDCV+AEPVVR L + + Sbjct: 7 VSVSGFEEFH---RAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEG 63 Query: 410 IIFVYVDVGDREYWKDKECPFRTDSRSKLMVIPTL 514 +F+Y VG++ YWKD FR K+ +PTL Sbjct: 64 CVFIYCQVGEKPYWKDPNNDFR--KNLKVTAVPTL 96 >AJ344101-1|CAC51435.1| 123|Homo sapiens putative 42-9-9 protein protein. Length = 123 Score = 92.3 bits (219), Expect = 9e-19 Identities = 44/95 (46%), Positives = 58/95 (61%), Gaps = 1/95 (1%) Frame = +2 Query: 233 VDLKGFEEFSKYTRAIDSR-GPPVFFYFSGSKLPDGNSWCPDCVEAEPVVRHYLSELDKS 409 V + GFEEF RA++ G +F YF+GSK G SWCPDCV+AEPVVR L + + Sbjct: 7 VSVSGFEEFH---RAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEG 63 Query: 410 IIFVYVDVGDREYWKDKECPFRTDSRSKLMVIPTL 514 +F+Y VG++ YWKD FR K+ +PTL Sbjct: 64 CVFIYCQVGEKPYWKDPNNDFR--KNLKVTAVPTL 96 >X77584-1|CAA54687.1| 105|Homo sapiens ATL-derived factor/thioredoxin protein. Length = 105 Score = 29.5 bits (63), Expect = 7.3 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +2 Query: 341 SWCPDCVEAEPVVRHYLSELDKSIIFVYVDVGD 439 +WC C +P H LSE ++IF+ VDV D Sbjct: 30 TWCGPCKMIKPFF-HSLSEKYSNVIFLEVDVDD 61 >X54539-1|CAA38410.1| 105|Homo sapiens thioredoxin protein. Length = 105 Score = 29.5 bits (63), Expect = 7.3 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +2 Query: 341 SWCPDCVEAEPVVRHYLSELDKSIIFVYVDVGD 439 +WC C +P H LSE ++IF+ VDV D Sbjct: 30 TWCGPCKMIKPFF-HSLSEKYSNVIFLEVDVDD 61 >CR407665-1|CAG28593.1| 105|Homo sapiens TXN protein. Length = 105 Score = 29.5 bits (63), Expect = 7.3 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +2 Query: 341 SWCPDCVEAEPVVRHYLSELDKSIIFVYVDVGD 439 +WC C +P H LSE ++IF+ VDV D Sbjct: 30 TWCGPCKMIKPFF-HSLSEKYSNVIFLEVDVDD 61 >BC054866-1|AAH54866.1| 105|Homo sapiens thioredoxin protein. Length = 105 Score = 29.5 bits (63), Expect = 7.3 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +2 Query: 341 SWCPDCVEAEPVVRHYLSELDKSIIFVYVDVGD 439 +WC C +P H LSE ++IF+ VDV D Sbjct: 30 TWCGPCKMIKPFF-HSLSEKYSNVIFLEVDVDD 61 >BC003377-1|AAH03377.1| 105|Homo sapiens thioredoxin protein. Length = 105 Score = 29.5 bits (63), Expect = 7.3 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +2 Query: 341 SWCPDCVEAEPVVRHYLSELDKSIIFVYVDVGD 439 +WC C +P H LSE ++IF+ VDV D Sbjct: 30 TWCGPCKMIKPFF-HSLSEKYSNVIFLEVDVDD 61 >AY004872-1|AAF87085.1| 105|Homo sapiens thioredoxin protein. Length = 105 Score = 29.5 bits (63), Expect = 7.3 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +2 Query: 341 SWCPDCVEAEPVVRHYLSELDKSIIFVYVDVGD 439 +WC C +P H LSE ++IF+ VDV D Sbjct: 30 TWCGPCKMIKPFF-HSLSEKYSNVIFLEVDVDD 61 >AL158158-1|CAI14066.1| 105|Homo sapiens thioredoxin protein. Length = 105 Score = 29.5 bits (63), Expect = 7.3 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +2 Query: 341 SWCPDCVEAEPVVRHYLSELDKSIIFVYVDVGD 439 +WC C +P H LSE ++IF+ VDV D Sbjct: 30 TWCGPCKMIKPFF-HSLSEKYSNVIFLEVDVDD 61 >AF548001-1|AAN33187.1| 105|Homo sapiens thioredoxin protein. Length = 105 Score = 29.5 bits (63), Expect = 7.3 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +2 Query: 341 SWCPDCVEAEPVVRHYLSELDKSIIFVYVDVGD 439 +WC C +P H LSE ++IF+ VDV D Sbjct: 30 TWCGPCKMIKPFF-HSLSEKYSNVIFLEVDVDD 61 >AF313911-1|AAG34699.1| 105|Homo sapiens thioredoxin protein. Length = 105 Score = 29.5 bits (63), Expect = 7.3 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +2 Query: 341 SWCPDCVEAEPVVRHYLSELDKSIIFVYVDVGD 439 +WC C +P H LSE ++IF+ VDV D Sbjct: 30 TWCGPCKMIKPFF-HSLSEKYSNVIFLEVDVDD 61 >U49356-1|AAA90924.1| 2285|Homo sapiens DNA polymerase epsilon catalytic subunit protein. Length = 2285 Score = 29.1 bits (62), Expect = 9.7 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +3 Query: 135 IHNLTVGNLYVFKKYIKIY*TNQVLHFPKWL 227 + ++ VG + +Y IY NQV+HF +WL Sbjct: 1794 LKSMVVGWVKEITQYHNIYADNQVMHFYRWL 1824 >S60080-1|AAA15448.1| 2257|Homo sapiens DNA polymerase epsilon catalytic subunit protein. Length = 2257 Score = 29.1 bits (62), Expect = 9.7 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +3 Query: 135 IHNLTVGNLYVFKKYIKIY*TNQVLHFPKWL 227 + ++ VG + +Y IY NQV+HF +WL Sbjct: 1766 LKSMVVGWVKEITQYHNIYADNQVMHFYRWL 1796 >L09561-1|AAC19148.1| 2286|Homo sapiens DNA polymerase epsilon, catalytic polypeptide protein. Length = 2286 Score = 29.1 bits (62), Expect = 9.7 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +3 Query: 135 IHNLTVGNLYVFKKYIKIY*TNQVLHFPKWL 227 + ++ VG + +Y IY NQV+HF +WL Sbjct: 1795 LKSMVVGWVKEITQYHNIYADNQVMHFYRWL 1825 >J04026-1|AAA74596.1| 105|Homo sapiens thioredoxin protein. Length = 105 Score = 29.1 bits (62), Expect = 9.7 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +2 Query: 341 SWCPDCVEAEPVVRHYLSELDKSIIFVYVDVGD 439 +WC C P H LSE ++IF+ VDV D Sbjct: 30 TWCGPCKMINPFF-HSLSEKYSNVIFLEVDVDD 61 >BC087613-1|AAH87613.1| 797|Homo sapiens POLE protein protein. Length = 797 Score = 29.1 bits (62), Expect = 9.7 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +3 Query: 135 IHNLTVGNLYVFKKYIKIY*TNQVLHFPKWL 227 + ++ VG + +Y IY NQV+HF +WL Sbjct: 306 LKSMVVGWVKEITQYHNIYADNQVMHFYRWL 336 >BC007599-1|AAH07599.1| 797|Homo sapiens Unknown (protein for IMAGE:3347229) protein. Length = 797 Score = 29.1 bits (62), Expect = 9.7 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +3 Query: 135 IHNLTVGNLYVFKKYIKIY*TNQVLHFPKWL 227 + ++ VG + +Y IY NQV+HF +WL Sbjct: 306 LKSMVVGWVKEITQYHNIYADNQVMHFYRWL 336 >AY273166-1|AAP12650.1| 2265|Homo sapiens polymerase (DNA directed), epsilon protein. Length = 2265 Score = 29.1 bits (62), Expect = 9.7 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +3 Query: 135 IHNLTVGNLYVFKKYIKIY*TNQVLHFPKWL 227 + ++ VG + +Y IY NQV+HF +WL Sbjct: 1774 LKSMVVGWVKEITQYHNIYADNQVMHFYRWL 1804 >AF276919-1|AAF86466.1| 105|Homo sapiens thioredoxin 1 protein. Length = 105 Score = 29.1 bits (62), Expect = 9.7 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +2 Query: 341 SWCPDCVEAEPVVRHYLSELDKSIIFVYVDVGD 439 +WC C P H LSE ++IF+ VDV D Sbjct: 30 TWCGPCKMINPFF-HSLSEKYSNVIFLEVDVDD 61 >AF127975-3|AAD44692.1| 2243|Homo sapiens DNA polymerase epsilon catalytic subunit protein isoform c protein. Length = 2243 Score = 29.1 bits (62), Expect = 9.7 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +3 Query: 135 IHNLTVGNLYVFKKYIKIY*TNQVLHFPKWL 227 + ++ VG + +Y IY NQV+HF +WL Sbjct: 1752 LKSMVVGWVKEITQYHNIYADNQVMHFYRWL 1782 >AF127975-2|AAD44691.1| 2286|Homo sapiens DNA polymerase epsilon catalytic subunit protein isoform b protein. Length = 2286 Score = 29.1 bits (62), Expect = 9.7 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +3 Query: 135 IHNLTVGNLYVFKKYIKIY*TNQVLHFPKWL 227 + ++ VG + +Y IY NQV+HF +WL Sbjct: 1795 LKSMVVGWVKEITQYHNIYADNQVMHFYRWL 1825 >AF127975-1|AAD44690.1| 2297|Homo sapiens DNA polymerase epsilon catalytic subunit protein isoform a protein. Length = 2297 Score = 29.1 bits (62), Expect = 9.7 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +3 Query: 135 IHNLTVGNLYVFKKYIKIY*TNQVLHFPKWL 227 + ++ VG + +Y IY NQV+HF +WL Sbjct: 1806 LKSMVVGWVKEITQYHNIYADNQVMHFYRWL 1836 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 69,542,079 Number of Sequences: 237096 Number of extensions: 1368465 Number of successful extensions: 2349 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 2293 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2349 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4876707572 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -