BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0351 (508 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090817-1|BAC57909.1| 344|Anopheles gambiae gag-like protein p... 26 0.64 AY496421-1|AAS80138.1| 439|Anopheles gambiae bacteria responsiv... 23 7.9 >AB090817-1|BAC57909.1| 344|Anopheles gambiae gag-like protein protein. Length = 344 Score = 26.2 bits (55), Expect = 0.64 Identities = 16/68 (23%), Positives = 30/68 (44%), Gaps = 5/68 (7%) Frame = +3 Query: 195 TSVTNSDAMAPRLDQSASKSPQAEETGPKRLLKLQKYHRFLSTLTP-----QEMPMATRG 359 TS +D P+ + ++ GP L +LQ+ + S LTP + +P G Sbjct: 31 TSFDGNDGFGPQTRKGRRPVADDQQPGPSGLQRLQQQQQQPSRLTPVREAVENIPSPRNG 90 Query: 360 LAVSKGPV 383 +++G + Sbjct: 91 PNINEGSI 98 >AY496421-1|AAS80138.1| 439|Anopheles gambiae bacteria responsive protein 2 protein. Length = 439 Score = 22.6 bits (46), Expect = 7.9 Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +2 Query: 320 DPDSSGNADGYPRTGRFQGTSPGS-SWLSFRTS 415 DPD++GN GY + G + S+ FR S Sbjct: 391 DPDTAGNKAGYVKAKNLGGIAINDLSYDDFRGS 423 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 548,543 Number of Sequences: 2352 Number of extensions: 11288 Number of successful extensions: 24 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 45668772 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -