BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0351 (508 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g36090.1 68417.m05137 oxidoreductase, 2OG-Fe(II) oxygenase fa... 28 3.1 At1g17450.1 68414.m02137 ATP phosphoribosyltransferase -related ... 28 3.1 At1g12940.1 68414.m01503 high-affinity nitrate transporter, puta... 28 3.1 At2g17033.2 68415.m01965 pentatricopeptide (PPR) repeat-containi... 28 4.2 At2g17033.1 68415.m01964 pentatricopeptide (PPR) repeat-containi... 28 4.2 At2g45980.1 68415.m05716 expressed protein 27 5.5 At2g17970.1 68415.m02084 oxidoreductase, 2OG-Fe(II) oxygenase fa... 27 5.5 At1g71440.1 68414.m08253 tubulin folding cofactor E / Pfifferlin... 27 5.5 At5g37380.2 68418.m04492 DNAJ heat shock N-terminal domain-conta... 27 9.6 At5g37380.1 68418.m04491 DNAJ heat shock N-terminal domain-conta... 27 9.6 At3g52525.1 68416.m05776 ovate protein, putative 83% similar to ... 27 9.6 At3g23930.1 68416.m03006 expressed protein 27 9.6 At3g14120.2 68416.m01786 expressed protein similar to Nuclear po... 27 9.6 At3g14120.1 68416.m01785 expressed protein similar to Nuclear po... 27 9.6 At3g09180.1 68416.m01090 expressed protein 27 9.6 At1g79480.1 68414.m09263 hypothetical protein low similarity to ... 27 9.6 >At4g36090.1 68417.m05137 oxidoreductase, 2OG-Fe(II) oxygenase family protein similar to At2g17970, At2g17960; contains PF03171 2OG-Fe(II) oxygenase superfamily domain Length = 385 Score = 28.3 bits (60), Expect = 3.1 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = -3 Query: 77 SCLKVSLKKII*WYLIQ*TLVPNSC 3 S KV +K+++ W+++ T VP+SC Sbjct: 301 SIFKVIIKRLVGWHVLPPTCVPDSC 325 >At1g17450.1 68414.m02137 ATP phosphoribosyltransferase -related contains weak similarity to Swiss-Prot:P10366 ATP phosphoribosyltransferase [Escherichia coli] Length = 1402 Score = 28.3 bits (60), Expect = 3.1 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +3 Query: 96 RIEVLQKCSRQRKA*KSLCRRTKMKYAGHI 185 R+++L K + RKA SLC +YA H+ Sbjct: 703 RVQILMKNDKFRKAIMSLCNLLSERYARHL 732 >At1g12940.1 68414.m01503 high-affinity nitrate transporter, putative similar to trans-membrane nitrate transporter protein AtNRT2:1 [Arabidopsis thaliana] GI:3747058, high-affinity nitrate transporter ACH1 [Arabidopsis thaliana] GI:3608362 Length = 502 Score = 28.3 bits (60), Expect = 3.1 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -1 Query: 289 SSLF-GPVSSACGDLLADWSSLGAMASELVTLVV 191 SS+F GPV + + A W +LG A++L+ +V Sbjct: 158 SSMFSGPVVGSANGIAAGWGNLGGGATQLIMPIV 191 >At2g17033.2 68415.m01965 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 505 Score = 27.9 bits (59), Expect = 4.2 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 Query: 425 LTETGKHIDVPEASKWLAKLLQYNVP 502 L+ G H +P+ WL KL +NVP Sbjct: 321 LSSYGAHDALPQMGSWLQKLKGFNVP 346 >At2g17033.1 68415.m01964 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 504 Score = 27.9 bits (59), Expect = 4.2 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 Query: 425 LTETGKHIDVPEASKWLAKLLQYNVP 502 L+ G H +P+ WL KL +NVP Sbjct: 320 LSSYGAHDALPQMGSWLQKLKGFNVP 345 >At2g45980.1 68415.m05716 expressed protein Length = 256 Score = 27.5 bits (58), Expect = 5.5 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = -2 Query: 414 DVRKDSHELPGLVPWKRPVLG*PSAFPEESGSTGICDIFAASAVSSV 274 DV+K +H LP WKR + S + + I +F A+AV+ + Sbjct: 153 DVKKSTHNLPCEAWWKRRAI---SMYSRTREANAIWSLFFAAAVTGL 196 >At2g17970.1 68415.m02084 oxidoreductase, 2OG-Fe(II) oxygenase family protein similar to At2g17960, At4g36090; contains PF03171 2OG-Fe(II) oxygenase superfamily domain Length = 507 Score = 27.5 bits (58), Expect = 5.5 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = -3 Query: 68 KVSLKKII*WYLIQ*TLVPNSC 3 KV ++K+I W+++ T VP+SC Sbjct: 300 KVIIRKLIKWHVLPPTCVPDSC 321 >At1g71440.1 68414.m08253 tubulin folding cofactor E / Pfifferling (PFI) almost identical to tubulin folding cofactor E (Pfifferling; PFI) GI:20514267 from [Arabidopsis thaliana]; identical to cDNA tubulin folding cofactor E, GI:20514266 Length = 531 Score = 27.5 bits (58), Expect = 5.5 Identities = 11/27 (40%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = -1 Query: 256 GDLLADWSSLGAMASELVTLVVL-LMC 179 G+L++DW +GA+ +L L L L C Sbjct: 169 GNLISDWEEIGALCEQLPALTTLNLSC 195 >At5g37380.2 68418.m04492 DNAJ heat shock N-terminal domain-containing protein similar to SP|Q9QYI4 DnaJ homolog subfamily B member 12 {Mus musculus}; contains Pfam profile PF00226: DnaJ domain Length = 431 Score = 26.6 bits (56), Expect = 9.6 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +3 Query: 180 HISKTTSVTNSDAMAPRLDQSASK-SPQAEETGP 278 + +KTT TN+ PR + A K +P A++T P Sbjct: 150 NFAKTTFTTNARTTTPRNNPPAQKTNPPAQKTNP 183 >At5g37380.1 68418.m04491 DNAJ heat shock N-terminal domain-containing protein similar to SP|Q9QYI4 DnaJ homolog subfamily B member 12 {Mus musculus}; contains Pfam profile PF00226: DnaJ domain Length = 431 Score = 26.6 bits (56), Expect = 9.6 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +3 Query: 180 HISKTTSVTNSDAMAPRLDQSASK-SPQAEETGP 278 + +KTT TN+ PR + A K +P A++T P Sbjct: 150 NFAKTTFTTNARTTTPRNNPPAQKTNPPAQKTNP 183 >At3g52525.1 68416.m05776 ovate protein, putative 83% similar to ovate protein (GI:23429649) [Lycopersicon esculentum]; contains TIGRFAM TIGR01568 : uncharacterized plant-specific domain TIGR01568 Length = 159 Score = 26.6 bits (56), Expect = 9.6 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = +3 Query: 276 PKRLLKLQKY-HRFLSTLTPQEMPMATRGLAVSK 374 PKR ++ H +S+ TP P+AT +AV K Sbjct: 39 PKRPSSTYRHCHSSISSATPSSTPLATASVAVEK 72 >At3g23930.1 68416.m03006 expressed protein Length = 224 Score = 26.6 bits (56), Expect = 9.6 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = -3 Query: 362 QSSGSHRHFLRSQGRQESVIFLQLQQSLR 276 QS G RH ++ + +E V+FLQL+++ R Sbjct: 23 QSRG-RRHLIKERDEREKVMFLQLKEAER 50 >At3g14120.2 68416.m01786 expressed protein similar to Nuclear pore complex protein Nup107 (Nucleoporin Nup107) (107 kDa nucleoporin) (p105) (Swiss-Prot:P52590) [Rattus norvegicus] Length = 1077 Score = 26.6 bits (56), Expect = 9.6 Identities = 17/62 (27%), Positives = 26/62 (41%) Frame = +2 Query: 320 DPDSSGNADGYPRTGRFQGTSPGSSWLSFRTSSGDLTETGKHIDVPEASKWLAKLLQYNV 499 DP++ D + R + TSP LS S L G +I P + L + ++ V Sbjct: 13 DPEALSVRDQFRRYRKRHSTSPHEEMLSSNVSENRLLYDGHNIHSPTNTALLLENIKEEV 72 Query: 500 PN 505 N Sbjct: 73 DN 74 >At3g14120.1 68416.m01785 expressed protein similar to Nuclear pore complex protein Nup107 (Nucleoporin Nup107) (107 kDa nucleoporin) (p105) (Swiss-Prot:P52590) [Rattus norvegicus] Length = 1101 Score = 26.6 bits (56), Expect = 9.6 Identities = 17/62 (27%), Positives = 26/62 (41%) Frame = +2 Query: 320 DPDSSGNADGYPRTGRFQGTSPGSSWLSFRTSSGDLTETGKHIDVPEASKWLAKLLQYNV 499 DP++ D + R + TSP LS S L G +I P + L + ++ V Sbjct: 13 DPEALSVRDQFRRYRKRHSTSPHEEMLSSNVSENRLLYDGHNIHSPTNTALLLENIKEEV 72 Query: 500 PN 505 N Sbjct: 73 DN 74 >At3g09180.1 68416.m01090 expressed protein Length = 402 Score = 26.6 bits (56), Expect = 9.6 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -1 Query: 346 IGIS*GVRVDRNL*YFCSFSSLFGPVSSACGDLLA 242 +G G + L + CSF S+F + CG LLA Sbjct: 328 LGFGTGTALYSLLLWICSFESVFSKPCTKCGRLLA 362 >At1g79480.1 68414.m09263 hypothetical protein low similarity to beta-1,3-glucanase-like protein GI:9758115 from [Arabidopsis thaliana] Length = 356 Score = 26.6 bits (56), Expect = 9.6 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = -2 Query: 363 PVLG*PSAFPEESGSTGICDIFAASAVSSVRFPQPVVTCSPT-GPASGPW 217 PVLG P + P S TG ++ + + +P P+ SP+ P S W Sbjct: 218 PVLGPPYSEPGPSTPTGSIPSPSSGFLPPIVYPPPMAPPSPSVTPTSAYW 267 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,340,985 Number of Sequences: 28952 Number of extensions: 238373 Number of successful extensions: 749 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 729 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 749 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 908059136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -