BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0346 (637 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 23 2.8 DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 21 8.6 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 22.6 bits (46), Expect = 2.8 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = -2 Query: 378 RLVRGIGTHRILLQRSPQYSRFPFRSSSSV 289 R V + ILL+ ++ FPFR ++ + Sbjct: 189 RAVIDFDNNEILLRNGEKHHSFPFRKTTEI 218 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 21.0 bits (42), Expect = 8.6 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +3 Query: 399 GYQTPESAKVENRVRSGDVTGS 464 GY TPES E R+ D+T S Sbjct: 44 GYHTPESLHYEG--RAVDITTS 63 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,480 Number of Sequences: 336 Number of extensions: 3545 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16397237 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -