BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0346 (637 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g13760.1 68415.m01520 hypothetical protein 27 1.5 At5g62780.1 68418.m07881 DNAJ heat shock N-terminal domain-conta... 29 3.4 At3g03680.1 68416.m00371 C2 domain-containing protein contains I... 28 4.5 At2g37390.1 68415.m04585 heavy-metal-associated domain-containin... 28 4.5 At5g11920.1 68418.m01394 glycosyl hydrolase family 32 protein si... 28 6.0 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 28 6.0 At1g19220.1 68414.m02392 transcriptional factor B3 family protei... 28 6.0 At5g15730.1 68418.m01840 serine/threonine protein kinase, putati... 27 7.9 At3g42820.1 68416.m04484 hypothetical protein hypothetical prote... 27 7.9 At2g23260.1 68415.m02778 UDP-glucoronosyl/UDP-glucosyl transfera... 27 7.9 >At2g13760.1 68415.m01520 hypothetical protein Length = 209 Score = 27.1 bits (57), Expect(2) = 1.5 Identities = 14/57 (24%), Positives = 30/57 (52%) Frame = +3 Query: 108 SASPKPGIDVFQIDIEPEEAQKYLNSPPFTDPQLAGRTAVLPLIKYNDPRFRTVEAG 278 ++SP PG++ ++++ E+A L+S P +T + L++ ND + + G Sbjct: 37 ASSPSPGMNSIDLNMDSEDANFSLSSRPMG----LKKTKLKQLLEQNDKLIKAITKG 89 Score = 21.4 bits (43), Expect(2) = 1.5 Identities = 14/49 (28%), Positives = 20/49 (40%) Frame = +3 Query: 315 IENTEDYVEEVYDASQYHGQDGLGAYAYGYQTPESAKVENRVRSGDVTG 461 IEN + E + H +DG G+ +G Q S E+ V G Sbjct: 129 IENERKRILEKRAQTNQHEEDGEGSQYHGSQYRASHYQESPSHGKQVQG 177 >At5g62780.1 68418.m07881 DNAJ heat shock N-terminal domain-containing protein contains Pfam PF00226: DnaJ domain; similar to dnaJ (GI:144832) [Clostridium acetobutylicum] Length = 207 Score = 28.7 bits (61), Expect = 3.4 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -1 Query: 292 CPRVGPASTVRNLGSLYLINGKTAVR 215 CP G S + N+ S +ING+T +R Sbjct: 104 CPNCGQNSAMTNISSTEVINGRTFIR 129 >At3g03680.1 68416.m00371 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1017 Score = 28.3 bits (60), Expect = 4.5 Identities = 25/83 (30%), Positives = 36/83 (43%), Gaps = 6/83 (7%) Frame = +3 Query: 357 SQYHGQDGLGAYAYGYQTPES-AKVENRVRSGDVTGSY---IYK--DGKNDLIKVRYWSD 518 SQ G+ GL AY P + A E + + T I K DGK + + Sbjct: 120 SQIKGEIGLKAYYVDENPPAAPAATEPKPEAAAATEEKPPEIAKAEDGKKETEAAKTEEK 179 Query: 519 RDGFHQEDNLPKVELKQVEEAPD 587 ++G +E+ PK E K E+ PD Sbjct: 180 KEGDKKEEEKPKEEAKPDEKKPD 202 >At2g37390.1 68415.m04585 heavy-metal-associated domain-containing protein contains Pfam PF00403: Heavy-metal-associated domain; similar to copper homeostasis factor (CCH) (ATX1) (GB:U88711) (TIGR_Ath1:At3g56240) [Arabidopsis thaliana] Length = 259 Score = 28.3 bits (60), Expect = 4.5 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +1 Query: 424 RSKIASDPETSPARISTRTAKTISSRYVTGQTVTVSTRKTT 546 R + SDP++ + AKT+ + G+ T++ +KTT Sbjct: 134 RYLLGSDPDSITGSVDQDPAKTVEAEAPAGEDKTLTEKKTT 174 >At5g11920.1 68418.m01394 glycosyl hydrolase family 32 protein similar to fructan 1-exohydrolase IIa GI:13940209 from [Cichorium intybus]; contains Pfam profile PF00251: Glycosyl hydrolases family 32 Length = 550 Score = 27.9 bits (59), Expect = 6.0 Identities = 13/48 (27%), Positives = 27/48 (56%), Gaps = 2/48 (4%) Frame = +3 Query: 387 AYAYGYQTPESAKVENRVRSGDVTGSYIYKDGKNDLI--KVRYWSDRD 524 +Y G +T +++V ++ G+ Y++ DG+N +I + WS R+ Sbjct: 494 SYGVGGKTVITSRVYPKLAIGEAAKLYVFNDGENGVIMTSLEAWSMRN 541 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 27.9 bits (59), Expect = 6.0 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 428 RKSRQIRRRHRLVYLQGRQKRSHQ 499 R S + + RHRL+ +G QK +HQ Sbjct: 201 RLSAENKTRHRLIQQKGHQKENHQ 224 >At1g19220.1 68414.m02392 transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related contains Pfam profile: PF02309 AUX/IAA family Length = 1086 Score = 27.9 bits (59), Expect = 6.0 Identities = 18/52 (34%), Positives = 23/52 (44%), Gaps = 3/52 (5%) Frame = +3 Query: 132 DVFQIDIEPEEAQKYLNSPPFT---DPQLAGRTAVLPLIKYNDPRFRTVEAG 278 D I I A NS PFT +P+ + V+PL KYN + V G Sbjct: 242 DSMHIGILAAAAHANANSSPFTIFFNPRASPSEFVVPLAKYNKALYAQVSLG 293 >At5g15730.1 68418.m01840 serine/threonine protein kinase, putative similar to protein-serine/threonine kinase [Nicotiana tabacum] gi|505146|dbj|BAA06538 Length = 434 Score = 27.5 bits (58), Expect = 7.9 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = -2 Query: 423 SQIREFGIRRHMHLDRLVRGI-GTHRILLQRSPQY-SRFPFRSSSSVQEWGLLQL 265 +++ +FG+ + M LDR+ G+ GTH + P Y S + S + +G++ L Sbjct: 251 AKVADFGLSKEMVLDRMTSGLKGTHGYM---DPTYISTNKYTMKSDIYSFGVIIL 302 >At3g42820.1 68416.m04484 hypothetical protein hypothetical proteins - Arabidopsis thaliana Length = 906 Score = 27.5 bits (58), Expect = 7.9 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +3 Query: 414 ESAKVENRVRSGDVTGSYIYKDGKNDLIKVRYWSDRDGFHQEDNLP 551 ESA++++ + G G Y+ G N+L + Y D F +DN P Sbjct: 617 ESAEIKDNLAVGIPEGEYMDLSGTNELARCAY---NDVFTGQDNQP 659 >At2g23260.1 68415.m02778 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 456 Score = 27.5 bits (58), Expect = 7.9 Identities = 28/113 (24%), Positives = 47/113 (41%), Gaps = 7/113 (6%) Frame = +3 Query: 48 KKKEETCCVLCLFSPWVAVVSASPKPGIDVFQIDIEPEEA---QKYLNSPPFTDPQLAGR 218 ++K +C + F+PWV V+AS + I + + Y+ + F D + + Sbjct: 100 EEKRYSCIISSPFTPWVPAVAASHNISCAILWIQACGAYSVYYRYYMKTNSFPDLEDLNQ 159 Query: 219 TA---VLPLIKYND-PRFRTVEAGPTLGHYWKNGKEIENTEDYVEEVYDASQY 365 T LPL++ D P F G H++ E + YV+ V S Y Sbjct: 160 TVELPALPLLEVRDLPSFMLPSGG---AHFYNLMAEFADCLRYVKWVLVNSFY 209 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,800,490 Number of Sequences: 28952 Number of extensions: 330179 Number of successful extensions: 1089 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1050 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1089 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1305036432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -