BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0345 (551 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g61980.1 68418.m07779 ARF GTPase-activating domain-containing... 29 2.7 At5g54540.1 68418.m06790 expressed protein 27 8.3 >At5g61980.1 68418.m07779 ARF GTPase-activating domain-containing protein similar to GCN4-complementing protein (GCP1) GI:6465806 from [Arabidopsis thaliana] Length = 850 Score = 28.7 bits (61), Expect = 2.7 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +1 Query: 178 VCATTTELQYNRTAVNHKSQSINGNQFARSSTMQLGTSYPIEQAETGQ 321 V A+ Q A+ S G+ F+ S + L Y IEQAE+G+ Sbjct: 445 VIASLLSFQTPERAIMRLSTVDGGDTFSASDSGSLADPYDIEQAESGE 492 >At5g54540.1 68418.m06790 expressed protein Length = 297 Score = 27.1 bits (57), Expect = 8.3 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +1 Query: 199 LQYNRTAVNHKSQSINGNQFARSSTMQ 279 LQ N+TAV+ + +S N +Q RSST + Sbjct: 195 LQTNKTAVSSQVESDNDDQSERSSTTE 221 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,383,893 Number of Sequences: 28952 Number of extensions: 147861 Number of successful extensions: 252 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 250 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 252 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1043173136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -