BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0343 (544 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 23 2.7 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 8.1 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 22.6 bits (46), Expect = 2.7 Identities = 21/81 (25%), Positives = 35/81 (43%), Gaps = 3/81 (3%) Frame = +3 Query: 276 ILLSRCHCINDGWHY*WKSSSSKAIVNVNMAWISVQCVT-DIMLL*KNLKSVSLT--ISC 446 I + R I Y K + + IV V++ W+ C++ +L+ N + S T C Sbjct: 135 ISVDRFCAITKPLKYGVKRTPRRMIVYVSLVWLGAACISLPPLLIMGNEHTYSETGPSHC 194 Query: 447 ILCGKLGQIWYILTLKIFWTP 509 ++C Y TL F+ P Sbjct: 195 VVCQNFFYQIY-ATLGSFYIP 214 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.0 bits (42), Expect = 8.1 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -3 Query: 173 PSSSDPPADSCVST 132 P++S PA+ C ST Sbjct: 741 PNASPSPAEQCAST 754 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,377 Number of Sequences: 438 Number of extensions: 4046 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15459066 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -