BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0341 (563 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q0VJV2 Cluster: Like moricin; n=3; Manduca sexta|Rep: L... 46 8e-04 UniRef50_Q6UV17 Cluster: Endonuclease and reverse transcriptase-... 36 0.65 >UniRef50_Q0VJV2 Cluster: Like moricin; n=3; Manduca sexta|Rep: Like moricin - Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm) Length = 248 Score = 45.6 bits (103), Expect = 8e-04 Identities = 22/33 (66%), Positives = 25/33 (75%) Frame = +1 Query: 187 MGDGNHSPSGGPYARLPTRAIKKNIHSLTICIM 285 MGDGNHSPSG PYA LPTRA K + SL I ++ Sbjct: 1 MGDGNHSPSGRPYASLPTRA-KMKLTSLFIFVI 32 >UniRef50_Q6UV17 Cluster: Endonuclease and reverse transcriptase-like protein; n=25; Arthropoda|Rep: Endonuclease and reverse transcriptase-like protein - Bombyx mori (Silk moth) Length = 986 Score = 35.9 bits (79), Expect = 0.65 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +3 Query: 144 GRQRLGSAPCTAEVHGRR 197 GRQRLGSAP AEVHGRR Sbjct: 969 GRQRLGSAPGIAEVHGRR 986 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 614,305,329 Number of Sequences: 1657284 Number of extensions: 12925297 Number of successful extensions: 28697 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 27859 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28684 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 37904934977 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -