Bombyx BLAST Result against spombe

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= P5PG0341
         (563 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC4D7.03 |pop2|sud1|F-box/WD repeat protein Pop2|Schizosacchar...    25   7.7  

>SPAC4D7.03 |pop2|sud1|F-box/WD repeat protein
           Pop2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 703

 Score = 25.0 bits (52), Expect = 7.7
 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 4/67 (5%)
 Frame = -1

Query: 197 PSP-MDFSSARGR-AKPLPTDVYKLCLASIVHCVIQTPRHIPHHRRHKNLASINVKT--L 30
           PSP +D S+     +KP+  D+  L L SIV      P  I  +   + L S N ++  L
Sbjct: 166 PSPKVDTSNTVSPGSKPISEDLEDLNLQSIVQTFEDLPEGIQSYAFFQLLRSCNRQSMRL 225

Query: 29  VPNSCSP 9
           + N C P
Sbjct: 226 LLNECEP 232


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,450,483
Number of Sequences: 5004
Number of extensions: 51569
Number of successful extensions: 104
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 102
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 104
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 238029836
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)