BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0338 (462 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44668| Best HMM Match : 7tm_1 (HMM E-Value=6.1e-05) 29 1.9 SB_50031| Best HMM Match : SOCS_box (HMM E-Value=2.7) 29 1.9 SB_58468| Best HMM Match : rve (HMM E-Value=1.2e-11) 27 5.7 >SB_44668| Best HMM Match : 7tm_1 (HMM E-Value=6.1e-05) Length = 1604 Score = 29.1 bits (62), Expect = 1.9 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +2 Query: 317 NIDSSITCIRCRPVCMCLSAGTFYFYCIDGWTSSQP 424 N+ S+T + P C C + GT+Y C G QP Sbjct: 1015 NVSESVTHQKAGPGCRCSANGTWYL-CDQGAAGKQP 1049 >SB_50031| Best HMM Match : SOCS_box (HMM E-Value=2.7) Length = 256 Score = 29.1 bits (62), Expect = 1.9 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +2 Query: 317 NIDSSITCIRCRPVCMCLSAGTFYFYCIDGWTSSQP 424 N+ S+T + P C C + GT+Y C G QP Sbjct: 188 NVSESVTHQKAGPGCRCSANGTWYL-CDQGAAGKQP 222 >SB_58468| Best HMM Match : rve (HMM E-Value=1.2e-11) Length = 257 Score = 27.5 bits (58), Expect = 5.7 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -3 Query: 400 YTIKIKRARAKTHAYRSTPNTCNRTVDISMFGTLYA 293 + ++I+R+ AK H +S NRT+ ++ YA Sbjct: 79 HNVRIQRSEAKNHKAQSVVERVNRTLSERLYSHQYA 114 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,014,493 Number of Sequences: 59808 Number of extensions: 307819 Number of successful extensions: 500 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 484 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 500 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 945255773 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -