BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0335 (561 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF510715-1|AAP47144.1| 470|Anopheles gambiae Rh-like glycoprote... 24 3.9 AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A... 23 5.2 AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease pr... 23 9.0 >AF510715-1|AAP47144.1| 470|Anopheles gambiae Rh-like glycoprotein protein. Length = 470 Score = 23.8 bits (49), Expect = 3.9 Identities = 8/13 (61%), Positives = 12/13 (92%) Frame = +2 Query: 416 HALHGVPAMLSSV 454 H LHG+PA+LS++ Sbjct: 339 HNLHGMPAVLSAI 351 >AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A2 protein. Length = 496 Score = 23.4 bits (48), Expect = 5.2 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +1 Query: 142 SEVYSTSEPPPAYRHRVS 195 +++YST EP A+ R+S Sbjct: 427 TDIYSTREPQLAFHQRIS 444 >AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease protein. Length = 364 Score = 22.6 bits (46), Expect = 9.0 Identities = 16/69 (23%), Positives = 31/69 (44%) Frame = -2 Query: 299 DERAATQLEANIKVPKMKEEATTVSAAIFAIWTEVDTLCR*AGGGSDVLYTSEGGYSGFI 120 ++R + + ++++P ++ EA A+ + LC GSD S G SG Sbjct: 258 EDRRPSDTQKHVELPGLEHEACNSVYAVANVTLSDKQLCIGGLNGSD----SCRGDSGGP 313 Query: 119 VIVAIESGW 93 ++ + GW Sbjct: 314 LMREVRGGW 322 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 626,204 Number of Sequences: 2352 Number of extensions: 13093 Number of successful extensions: 31 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52563375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -