BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0328 (635 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL031632-4|CAA21007.1| 451|Caenorhabditis elegans Hypothetical ... 31 0.69 U80837-7|AAB37907.1| 760|Caenorhabditis elegans Hypothetical pr... 28 4.9 >AL031632-4|CAA21007.1| 451|Caenorhabditis elegans Hypothetical protein Y32B12B.5 protein. Length = 451 Score = 31.1 bits (67), Expect = 0.69 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +2 Query: 326 ASNKNVMTIKKI*CPFLTVVRLALFLVLKCIVRKFTCFHE 445 + +++ T ++ C F VV ++ L+CI + +CFHE Sbjct: 84 SQDQSNQTTPRLHCQFSHVVPKIEYMFLRCITKHISCFHE 123 >U80837-7|AAB37907.1| 760|Caenorhabditis elegans Hypothetical protein F07E5.8 protein. Length = 760 Score = 28.3 bits (60), Expect = 4.9 Identities = 16/50 (32%), Positives = 31/50 (62%) Frame = -3 Query: 591 LSIILLHNRSLQELVKIVRLKPIFRS*VNIYKVVNDKKYCLYGIRNVNVS 442 L ++ HN +L+ + K++RLK FRS + + +N +++ L+ R N+S Sbjct: 270 LDVVGSHN-NLRSVRKLIRLKDEFRSIDDKWMSLNKQEHYLFMHRIANIS 318 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,088,132 Number of Sequences: 27780 Number of extensions: 260618 Number of successful extensions: 495 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 494 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 495 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1406256614 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -