BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0325 (524 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39739| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 29 2.3 SB_13245| Best HMM Match : Ion_trans (HMM E-Value=3.3e-25) 28 5.4 SB_37093| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 >SB_39739| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) Length = 1120 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -2 Query: 112 DVTVIDYDRYNLSGHHQKKCWCDKTD 35 D + +DY Y L H+ CWC D Sbjct: 790 DGSAVDYGTYTLVQCHEGYCWCSSPD 815 >SB_13245| Best HMM Match : Ion_trans (HMM E-Value=3.3e-25) Length = 816 Score = 27.9 bits (59), Expect = 5.4 Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -3 Query: 288 RTCSLSGLRTASQNH-HPSSSWTHPSLPS 205 +T LS L T S H HP+ W+ P LPS Sbjct: 319 QTSWLSILATESNKHFHPTDPWSGPYLPS 347 >SB_37093| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 27.5 bits (58), Expect = 7.2 Identities = 27/100 (27%), Positives = 47/100 (47%), Gaps = 6/100 (6%) Frame = -2 Query: 514 IVSSIGLKSLKCLLLYFWLSNFTFADIAIMFAVRSSISLRKRAMWISLTITR------TS 353 I+SS + +C L WL +F A +A + + S +R A +++ R S Sbjct: 46 ILSSCKRPTYRCALTSGWLRSFINAFLAALNVLALSERIRLGAPRLAINFLRHRLKVDAS 105 Query: 352 NANSSPMIVAVTVTTQAFIRRSHLFIVGPPYCLSKSPPIK 233 +++SP A+ VT Q + ++ PP ++KS P K Sbjct: 106 MSSTSPKCTAL-VTQQ--VNNVIYTLLMPPVDVTKSGPAK 142 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,137,710 Number of Sequences: 59808 Number of extensions: 364182 Number of successful extensions: 1062 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 961 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1061 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1184975377 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -