Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= P5PG0325
         (524 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY956763-1|AAX38250.1|  422|Homo sapiens heat shock protein 90Bb...    29   10.0 

>AY956763-1|AAX38250.1|  422|Homo sapiens heat shock protein 90Bb
           protein.
          Length = 422

 Score = 29.1 bits (62), Expect = 10.0
 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%)
 Frame = +3

Query: 144 MAEKHA-LIPDPITMYTQKETMKEVKDASKNLMGGDFERQ 260
           + EKH+  +  PIT+Y +KE  KE+ D       G+ E +
Sbjct: 164 VVEKHSQFLGYPITLYLEKEREKEISDGKAEEEKGEKEEE 203


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 78,461,232
Number of Sequences: 237096
Number of extensions: 1631593
Number of successful extensions: 4255
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 4091
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4255
length of database: 76,859,062
effective HSP length: 85
effective length of database: 56,705,902
effective search space used: 5046825278
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)