BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0324 (608 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0573 - 4580054-4580416 29 2.2 02_04_0475 + 23229046-23229480,23230062-23231205,23232187-232323... 27 8.8 >11_01_0573 - 4580054-4580416 Length = 120 Score = 29.5 bits (63), Expect = 2.2 Identities = 18/55 (32%), Positives = 22/55 (40%) Frame = -2 Query: 505 DSYFPQPFTGASGSKVPRLLSSYRSDYCA*LYTAKNTACFSRLISFCSLLLMQFC 341 D + P PF G P LL D Y ++ FSRL+S LL C Sbjct: 38 DMFIPSPFGGEMVDVDPDLLQDMSRDVEDPTYNERDFMKFSRLVSDSETLLYDGC 92 >02_04_0475 + 23229046-23229480,23230062-23231205,23232187-23232334, 23232776-23234225 Length = 1058 Score = 27.5 bits (58), Expect = 8.8 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 2/61 (3%) Frame = +1 Query: 220 LFTGNT-KEMR-RNREFRSQIFCRLFNLVIYSLKLERDCELAYRTALIKVNKMRLNGKNK 393 LF G K MR R E ++ F L Y LER+ E++ R K+NK + G+NK Sbjct: 155 LFMGKRLKNMRVRLTEIAAERTHYGFTLDTYPRDLERE-EISKRETTSKINKSAVVGRNK 213 Query: 394 Q 396 + Sbjct: 214 E 214 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,600,792 Number of Sequences: 37544 Number of extensions: 275973 Number of successful extensions: 677 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 664 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 677 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1454766756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -