BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0324 (608 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 23 1.8 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 23 1.8 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 2.3 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 4.1 DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase doma... 22 5.4 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 9.4 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 21 9.4 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 23.4 bits (48), Expect = 1.8 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 2/50 (4%) Frame = +1 Query: 247 RRNREFRSQIFCRLFNLVIYSLKLERDCELAYRTALIKVNKMRLN--GKN 390 RR R++ +C LF+L + D R + V RLN GKN Sbjct: 530 RRVASVRAETYCNLFSLSVDHFNAVLDQYPLMRRTMESVAAERLNKIGKN 579 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 23.4 bits (48), Expect = 1.8 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 2/50 (4%) Frame = +1 Query: 247 RRNREFRSQIFCRLFNLVIYSLKLERDCELAYRTALIKVNKMRLN--GKN 390 RR R++ +C LF+L + D R + V RLN GKN Sbjct: 498 RRVASVRAETYCNLFSLSVDHFNAVLDQYPLMRRTMESVAAERLNKIGKN 547 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.0 bits (47), Expect = 2.3 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +3 Query: 462 FDPDAPVKGCGK*ESRCGNGFLNLYI*H 545 FDPD P++ + +S NG + +I H Sbjct: 779 FDPDVPIELQIQKQSHTPNGIVKTWIAH 806 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 4.1 Identities = 14/47 (29%), Positives = 19/47 (40%) Frame = +1 Query: 25 TSGSPGCRKLLFYLKLVLRNRTTPMEH*RRPRYRGHYLRNCNKDAIR 165 +S S G R F +R H R YR R+C++D R Sbjct: 213 SSNSLGSRSRSFQRTSSCHSRYEDSRHEDRNSYRNDGERSCSRDRSR 259 >DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase domain protein protein. Length = 448 Score = 21.8 bits (44), Expect = 5.4 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 409 TAKNTACFSRLISFC 365 T K TACF + +C Sbjct: 166 TGKTTACFEPSLDYC 180 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.0 bits (42), Expect = 9.4 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -1 Query: 509 SRFLFSATLHRRIGVKSAPVVV 444 SRF F A LH + ++A +++ Sbjct: 1141 SRFEFRAALHEALRGRTAQLII 1162 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.0 bits (42), Expect = 9.4 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -3 Query: 567 SNYKLHRYVIYINSRNHYH 511 +NYK Y Y N+ N+Y+ Sbjct: 320 NNYKYSNYNNYNNNYNNYN 338 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,364 Number of Sequences: 438 Number of extensions: 3484 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17971191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -