BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0317 (571 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g06080.1 68414.m00637 delta 9 desaturase (ADS1) identical to ... 75 3e-14 At2g31360.1 68415.m03831 delta 9 desaturase (ADS2) identical to ... 73 1e-13 At1g06360.1 68414.m00672 fatty acid desaturase family protein si... 73 2e-13 At1g06100.1 68414.m00639 fatty acid desaturase family protein si... 69 2e-12 At3g15870.1 68416.m02007 fatty acid desaturase family protein si... 69 2e-12 At1g06350.1 68414.m00671 fatty acid desaturase family protein si... 69 2e-12 At3g15850.1 68416.m02005 fatty acid desaturase family protein si... 67 9e-12 At1g06090.1 68414.m00638 fatty acid desaturase family protein si... 66 1e-11 At1g06120.1 68414.m00641 fatty acid desaturase family protein si... 65 4e-11 At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipox... 28 5.0 At5g41180.1 68418.m05005 leucine-rich repeat protein kinase, put... 27 6.7 At5g41880.1 68418.m05099 DNA primase small subunit family contai... 27 8.8 At4g33730.1 68417.m04789 pathogenesis-related protein, putative ... 27 8.8 At4g17140.1 68417.m02580 pleckstrin homology (PH) domain-contain... 27 8.8 At1g78420.1 68414.m09138 expressed protein 27 8.8 >At1g06080.1 68414.m00637 delta 9 desaturase (ADS1) identical to delta 9 acyl-lipid desaturase (ADS1) GB:BAA25180 GI:2970034 from [Arabidopsis thaliana] Length = 305 Score = 75.4 bits (177), Expect = 3e-14 Identities = 31/79 (39%), Positives = 45/79 (56%) Frame = +2 Query: 332 AIVLFFLGNFGITAGAHRLWSHNGYKVKLPLEILLMVFNSIAFQNTIFTWVRDHRLHHKY 511 A++++ +G GIT HR +H +KV LE +A Q WV HR HH++ Sbjct: 67 ALIVYTVGGLGITVSYHRNLAHRSFKVPKWLEYFFAYCGLLAIQGDPIDWVSTHRYHHQF 126 Query: 512 TDTDADPHNATRGFFFSHI 568 TD+D DPH+ GF+FSH+ Sbjct: 127 TDSDRDPHSPNEGFWFSHL 145 >At2g31360.1 68415.m03831 delta 9 desaturase (ADS2) identical to delta 9 acyl-lipid desaturase (ADS2) GI:2970036 from [Arabidopsis thaliana] Length = 307 Score = 73.3 bits (172), Expect = 1e-13 Identities = 33/84 (39%), Positives = 49/84 (58%), Gaps = 1/84 (1%) Frame = +2 Query: 320 TSVFAIVLFF-LGNFGITAGAHRLWSHNGYKVKLPLEILLMVFNSIAFQNTIFTWVRDHR 496 ++++ LF+ +G GIT HR +H +KV LE LL +A Q WV HR Sbjct: 64 SALWVTFLFYTIGGLGITVSYHRNLAHRSFKVPKWLEYLLAYCALLAIQGDPIDWVSTHR 123 Query: 497 LHHKYTDTDADPHNATRGFFFSHI 568 HH++TD++ DPH+ GF+FSH+ Sbjct: 124 YHHQFTDSERDPHSPKEGFWFSHL 147 >At1g06360.1 68414.m00672 fatty acid desaturase family protein similar to delta 9 acyl-lipid desaturase (ADS1) GI:2970034 from [Arabidopsis thaliana] Length = 299 Score = 72.5 bits (170), Expect = 2e-13 Identities = 33/80 (41%), Positives = 44/80 (55%) Frame = +2 Query: 329 FAIVLFFLGNFGITAGAHRLWSHNGYKVKLPLEILLMVFNSIAFQNTIFTWVRDHRLHHK 508 F VL+ L + IT HR +H +K+ LE L F A Q WV HR HH+ Sbjct: 60 FGFVLYALTSLSITFSYHRNLAHRSFKLPKWLEYPLAYFAVFALQGDPLDWVSIHRFHHQ 119 Query: 509 YTDTDADPHNATRGFFFSHI 568 +TD+D DPH+ GF+FSH+ Sbjct: 120 FTDSDRDPHSPIEGFWFSHV 139 >At1g06100.1 68414.m00639 fatty acid desaturase family protein similar to delta 9 acyl-lipid desaturase (ADS1) GI:2970034 from [Arabidopsis thaliana] Length = 299 Score = 69.3 bits (162), Expect = 2e-12 Identities = 32/80 (40%), Positives = 43/80 (53%) Frame = +2 Query: 329 FAIVLFFLGNFGITAGAHRLWSHNGYKVKLPLEILLMVFNSIAFQNTIFTWVRDHRLHHK 508 F I+L L N IT HR +H +K+ LE +A Q WV HR HH+ Sbjct: 60 FGIILAILTNLCITFSYHRNLTHRSFKLPKWLEYPFAYSALLALQGDPLDWVSIHRFHHQ 119 Query: 509 YTDTDADPHNATRGFFFSHI 568 +TD+D DPH+ GF+FSH+ Sbjct: 120 FTDSDRDPHSPIEGFWFSHV 139 >At3g15870.1 68416.m02007 fatty acid desaturase family protein similar to delta 9 acyl-lipid desaturase (ADS1) GI:2970034 from [Arabidopsis thaliana] Length = 292 Score = 68.9 bits (161), Expect = 2e-12 Identities = 31/76 (40%), Positives = 42/76 (55%) Frame = +2 Query: 341 LFFLGNFGITAGAHRLWSHNGYKVKLPLEILLMVFNSIAFQNTIFTWVRDHRLHHKYTDT 520 L F+ IT HR SH + + LE L +AFQ WV +HR HHK+ +T Sbjct: 58 LVFINGICITLSYHRNLSHRSFDLPKWLEYLFAYGGVLAFQGDPIEWVSNHRYHHKHCET 117 Query: 521 DADPHNATRGFFFSHI 568 DPH+ T+GF+FSH+ Sbjct: 118 QRDPHSPTQGFWFSHM 133 >At1g06350.1 68414.m00671 fatty acid desaturase family protein similar to delta 9 acyl-lipid desaturase (ADS1) GI:2970034 from [Arabidopsis thaliana] Length = 300 Score = 68.9 bits (161), Expect = 2e-12 Identities = 40/111 (36%), Positives = 53/111 (47%) Frame = +2 Query: 236 VMNVIRFSYLHIAGLYGLYLCFTSAKLATSVFAIVLFFLGNFGITAGAHRLWSHNGYKVK 415 +++V+R S + I L F + K F +VLF L IT HR SH +K+ Sbjct: 31 LVDVVRASVVVIVHFLCLLAPF-NFKWEALRFGLVLFALTTLSITFSFHRNLSHRSFKIP 89 Query: 416 LPLEILLMVFNSIAFQNTIFTWVRDHRLHHKYTDTDADPHNATRGFFFSHI 568 LE A Q WV HR HH++TD+D DPH+ G FSHI Sbjct: 90 KWLEYPWAYSAVFALQGDPMDWVSIHRFHHQFTDSDRDPHSPKEGLLFSHI 140 >At3g15850.1 68416.m02005 fatty acid desaturase family protein similar to delta 9 acyl-lipid desaturase (ADS1) GI:2970034 from [Arabidopsis thaliana] Length = 371 Score = 66.9 bits (156), Expect = 9e-12 Identities = 33/84 (39%), Positives = 43/84 (51%) Frame = +2 Query: 317 ATSVFAIVLFFLGNFGITAGAHRLWSHNGYKVKLPLEILLMVFNSIAFQNTIFTWVRDHR 496 A SV + G GIT HR SH +K+ LE L + A Q WV HR Sbjct: 127 AVSVAFGLYIVTGLLGITLSFHRNLSHKAFKLPKWLEYLFAYCGAQALQGNPIDWVSTHR 186 Query: 497 LHHKYTDTDADPHNATRGFFFSHI 568 HH++ D+D DPH+ GF+FSH+ Sbjct: 187 YHHQFCDSDRDPHSPLDGFWFSHM 210 >At1g06090.1 68414.m00638 fatty acid desaturase family protein similar to delta 9 acyl-lipid desaturase GB:BAA25180 GI:2970034 (ADS1) from [Arabidopsis thaliana] Length = 299 Score = 66.5 bits (155), Expect = 1e-11 Identities = 29/80 (36%), Positives = 42/80 (52%) Frame = +2 Query: 329 FAIVLFFLGNFGITAGAHRLWSHNGYKVKLPLEILLMVFNSIAFQNTIFTWVRDHRLHHK 508 F ++L + + IT HR +H +K+ LE A Q WV HR HH+ Sbjct: 60 FGVILAIVTSLSITFSYHRNLTHKSFKLPKWLEYPFAYSALFALQGHPIDWVSTHRFHHQ 119 Query: 509 YTDTDADPHNATRGFFFSHI 568 +TD+D DPH+ GF+FSH+ Sbjct: 120 FTDSDRDPHSPIEGFWFSHV 139 >At1g06120.1 68414.m00641 fatty acid desaturase family protein similar to delta 9 acyl-lipid desaturase GB:BAA25180 GI:2970034 (ADS1) from [Arabidopsis thaliana]; supported by cDNA:gi_12083275_gb_AF332434.1_AF332434 Length = 299 Score = 64.9 bits (151), Expect = 4e-11 Identities = 30/80 (37%), Positives = 41/80 (51%) Frame = +2 Query: 329 FAIVLFFLGNFGITAGAHRLWSHNGYKVKLPLEILLMVFNSIAFQNTIFTWVRDHRLHHK 508 FA ++ N IT HR +H +K+ LE A Q WV HR HH+ Sbjct: 60 FAAMVGISTNLSITFSYHRNLTHRSFKLPKWLEYPFAYSALFALQGHPIDWVSTHRFHHQ 119 Query: 509 YTDTDADPHNATRGFFFSHI 568 +TD+D DPH+ GF+FSH+ Sbjct: 120 FTDSDRDPHSPIEGFWFSHV 139 >At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipoxygenase gi:1495804 [Solanum tuberosum], gi:1654140 [Lycopersicon esculentum], GB:CAB56692 [Arabidopsis thaliana] Length = 926 Score = 27.9 bits (59), Expect = 5.0 Identities = 13/47 (27%), Positives = 17/47 (36%) Frame = +1 Query: 430 PVDGLQQYCFSEHHFHMGERSQATSQVYGH*CRPS*CYERFFFLTHR 570 PVD + + H+G Q+ H R C E F HR Sbjct: 556 PVDATSNWMWQLAKAHVGSNDAGVHQLVNHWLRTHACLEPFILAAHR 602 >At5g41180.1 68418.m05005 leucine-rich repeat protein kinase, putative contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 664 Score = 27.5 bits (58), Expect = 6.7 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +3 Query: 306 QQNWLHRFLLLCYSSLGTLVLQLELIVCGLIMVTKS 413 +Q WL F ++ SS+G L L + C L + +S Sbjct: 273 RQTWLRNFEIVTGSSVGLLFLVVMFSACSLCKIKRS 308 >At5g41880.1 68418.m05099 DNA primase small subunit family contains Pfam profile: PF01896 DNA primase small subunit Length = 407 Score = 27.1 bits (57), Expect = 8.8 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = -1 Query: 262 IAKTYHVHHYNFVFDGRGLGCNEFF 188 I ++VH+ +DG+ GC+E++ Sbjct: 22 IENDFNVHYLRIYYDGKHPGCDEYY 46 >At4g33730.1 68417.m04789 pathogenesis-related protein, putative similar to SP|P33154 Pathogenesis-related protein 1 precursor (PR-1) {Arabidopsis thaliana}; contains Pfam profile PF00188: SCP-like extracellular protein Length = 172 Score = 27.1 bits (57), Expect = 8.8 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = +2 Query: 404 YKVKLPLEILLMVFNSIAFQNTIFTWVRDHRLHHKYTDTDADPHNATR 547 +KV + +LL++ N + + + H+Y D+ PHNA R Sbjct: 3 HKVAIETLVLLLLINYLTQIDVSSAQYSQYPQSHEYPDSYLRPHNAAR 50 >At4g17140.1 68417.m02580 pleckstrin homology (PH) domain-containing protein contains Pfam profile PF00169: PH domain Length = 1322 Score = 27.1 bits (57), Expect = 8.8 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 335 IVLFFLGNFGITAGAHRLWSH 397 + LFFL + G HRLW H Sbjct: 277 LYLFFLTDAGFLRNLHRLWKH 297 >At1g78420.1 68414.m09138 expressed protein Length = 401 Score = 27.1 bits (57), Expect = 8.8 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +1 Query: 433 VDGLQQYCFSEHHFHMGERSQATSQV 510 VDG+ + HH+ MGE + S V Sbjct: 322 VDGIDNHHHHRHHYEMGETGSSNSYV 347 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,736,716 Number of Sequences: 28952 Number of extensions: 227243 Number of successful extensions: 478 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 473 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 478 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1102220672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -