BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0316 (618 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41538-3|AAP31431.1| 142|Caenorhabditis elegans Hypothetical pr... 27 8.1 U41538-2|AAG00010.1| 997|Caenorhabditis elegans Hypothetical pr... 27 8.1 AF036687-2|AAB88311.2| 2224|Caenorhabditis elegans Hypothetical ... 27 8.1 >U41538-3|AAP31431.1| 142|Caenorhabditis elegans Hypothetical protein R04E5.8b protein. Length = 142 Score = 27.5 bits (58), Expect = 8.1 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = +1 Query: 499 PEVSDNR-QHINNVYVKGPPRTENFNFQNDRIHAEENYQN 615 P + NR QH N + GPPR N + R H +QN Sbjct: 60 PARAHNRGQHHNRGHHHGPPRNHNQDRNRHRNHDGNRHQN 99 >U41538-2|AAG00010.1| 997|Caenorhabditis elegans Hypothetical protein R04E5.8a protein. Length = 997 Score = 27.5 bits (58), Expect = 8.1 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = +1 Query: 499 PEVSDNR-QHINNVYVKGPPRTENFNFQNDRIHAEENYQN 615 P + NR QH N + GPPR N + R H +QN Sbjct: 904 PARAHNRGQHHNRGHHHGPPRNHNQDRNRHRNHDGNRHQN 943 >AF036687-2|AAB88311.2| 2224|Caenorhabditis elegans Hypothetical protein C08G9.2 protein. Length = 2224 Score = 27.5 bits (58), Expect = 8.1 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -1 Query: 108 CDYKRYYCNLEYSAGVCGA 52 C KRY CNL+ AG C A Sbjct: 1940 CVSKRYVCNLQRDAGPCTA 1958 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.316 0.133 0.388 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,884,880 Number of Sequences: 27780 Number of extensions: 211152 Number of successful extensions: 552 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 524 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 552 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1342816466 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -