BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0315 (626 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0083 - 1046086-1047086,1047976-1048161,1048266-1049247 28 7.0 >10_01_0083 - 1046086-1047086,1047976-1048161,1048266-1049247 Length = 722 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 4/39 (10%) Frame = +1 Query: 214 VPFVRHFFCAQLSL---SKSPIDNYGCQSDRQL-TSATS 318 VPFV F A +S + P+DNY C+S +ATS Sbjct: 266 VPFVLDFAIANVSCPAQGQPPLDNYACRSSNSFCVNATS 304 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,119,050 Number of Sequences: 37544 Number of extensions: 205244 Number of successful extensions: 384 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 375 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 384 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1525730988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -