BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0315 (626 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g29460.1 68414.m03604 auxin-responsive protein, putative simi... 30 1.4 At1g74170.1 68414.m08590 leucine-rich repeat family protein cont... 29 1.9 At4g14150.1 68417.m02183 phragmoplast-associated kinesin-related... 29 3.3 At1g34650.1 68414.m04309 homeobox-leucine zipper family protein ... 28 4.4 >At1g29460.1 68414.m03604 auxin-responsive protein, putative similar to auxin-induced protein 6B (SP:P33083) [Glycine max] Length = 148 Score = 29.9 bits (64), Expect = 1.4 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = +3 Query: 297 TAHVSNKSNLSQGRKMENKTFAKNTFIRIRVYFPLDYDFSQLFEELLSL 443 T + + S +E F T +IR FPL Y + +FEELL + Sbjct: 32 TTTTTTTTTTSSSTAVEKGCFVVYTVDKIRFAFPLSYLNNSVFEELLKI 80 >At1g74170.1 68414.m08590 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 1068 Score = 29.5 bits (63), Expect = 1.9 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = -3 Query: 567 FMSYSLPRKIKSLMFYNVNIFKATPVELRNQEWFV 463 F S+ LP+ +L+F NV++ K + L+N W + Sbjct: 485 FTSFQLPKSAHNLLFLNVSVNKFNHLFLQNFGWIL 519 >At4g14150.1 68417.m02183 phragmoplast-associated kinesin-related protein (PAKRP1) Length = 1292 Score = 28.7 bits (61), Expect = 3.3 Identities = 12/45 (26%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = +1 Query: 268 IDNYGCQSDRQLTSAT-SRIYLRVEKWKTKHLQKTLSYEFVCTSL 399 ++ + C R LT R++ R+++ + KH ++ L+Y+ C+ L Sbjct: 183 LEEHLCGDQRGLTPRVFERLFARIKEEQVKHAERQLNYQCRCSLL 227 >At1g34650.1 68414.m04309 homeobox-leucine zipper family protein / lipid-binding START domain-containing protein similar to homeobox 1 (GP:12002853) {Picea abies}; contains Pfam PF00046: Homeobox domain and Pfam PF01852: START domain Length = 708 Score = 28.3 bits (60), Expect = 4.4 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +2 Query: 218 RLFDISFAHNFHCQSHPLTITAVRVTDSSRQQQVEFISGSKNGKQNI 358 R ++ + HCQ +P+T A VT ++ V F+ S G+ + Sbjct: 552 RNLEVRHQWDVHCQGNPVTEAARFVTGPDQKNNVTFLQPSSVGEYKL 598 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,136,589 Number of Sequences: 28952 Number of extensions: 188642 Number of successful extensions: 380 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 373 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 380 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1275599520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -