BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0314 (602 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_1283 - 28957729-28959258,28959354-28959550,28959824-289600... 29 2.8 >06_03_1283 - 28957729-28959258,28959354-28959550,28959824-28960026, 28960097-28960424,28960524-28960661,28960765-28961020, 28961529-28961626,28963104-28963367,28964395-28964584 Length = 1067 Score = 29.1 bits (62), Expect = 2.8 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -2 Query: 316 FPFPIIVLKGLKAIVCRLCHFWCNPYQWVFLILDKSSL 203 +P P ++L GL +V HFW +P +W L+ + L Sbjct: 90 WPSPYVLLCGLLLVVSLFEHFW-HPLKWFALVAAAAGL 126 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,082,700 Number of Sequences: 37544 Number of extensions: 318575 Number of successful extensions: 622 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 614 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 622 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1431112012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -