BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0313 (310 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleo... 23 3.4 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 21 7.9 >AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleotidase protein. Length = 570 Score = 22.6 bits (46), Expect = 3.4 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -1 Query: 202 DVYVDRDHADCCECT 158 +V++DR+ CECT Sbjct: 358 EVFLDRESCRWCECT 372 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/36 (25%), Positives = 17/36 (47%) Frame = +1 Query: 148 NLH*YIHNSQHGHDQRKHLIMSNNHVKIQPKSYQGL 255 +LH +HGH ++ I+ + V + + GL Sbjct: 427 HLHALFSAVEHGHLEKARTILESTDVDVNSLNSDGL 462 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 215,504 Number of Sequences: 2352 Number of extensions: 3073 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 563,979 effective HSP length: 56 effective length of database: 432,267 effective search space used: 19884282 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -