BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0312 (497 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 26 0.19 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 23 1.8 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 23 1.8 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 26.2 bits (55), Expect = 0.19 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = +1 Query: 196 PGKSVVLSAFSVLPPLAQLALASDGET-HEELLKAIGFPDDDAIRTEFASKSR 351 P K + AF PPL + A+ +T ++KA+ F D T+ A K++ Sbjct: 406 PSKPMCAEAFQEFPPLGRFAVRDMRQTVAVGVIKAVTFKDAAGKVTKAAEKAQ 458 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 23.0 bits (47), Expect = 1.8 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -2 Query: 223 MPRGQRFSLDYFSLLR 176 +PRG+ FSL Y LLR Sbjct: 91 LPRGELFSLYYPQLLR 106 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 23.0 bits (47), Expect = 1.8 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -2 Query: 223 MPRGQRFSLDYFSLLR 176 +PRG+ FSL Y LLR Sbjct: 91 LPRGELFSLYYPQLLR 106 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,033 Number of Sequences: 438 Number of extensions: 2707 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13618701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -