BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0309 (597 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_10403| Best HMM Match : Death (HMM E-Value=9.3e-08) 31 0.93 SB_34706| Best HMM Match : Ion_trans_2 (HMM E-Value=2.1e-16) 30 1.6 SB_46345| Best HMM Match : AAA_5 (HMM E-Value=0.053) 29 2.9 SB_9093| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_3579| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_31094| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_5609| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 >SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4072 Score = 33.5 bits (73), Expect = 0.13 Identities = 19/42 (45%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Frame = +2 Query: 341 ARSKQIPLT-DLPGTTVAAVSE--SDTTSWPGAVAALDSLTV 457 A + +P+T +PGTTVAA + DTT+ PG AAL++ V Sbjct: 2436 AETTAVPVTTSVPGTTVAAETTVVRDTTAVPGTTAALEATAV 2477 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = +2 Query: 365 TDLPGTTVAAVSE--SDTTSWPGAVAALDSLTV 457 T +PGTTVAA + DTT+ PG AA ++ V Sbjct: 2680 TSVPGTTVAAETTVVRDTTAVPGTTAAPEATAV 2712 >SB_10403| Best HMM Match : Death (HMM E-Value=9.3e-08) Length = 302 Score = 30.7 bits (66), Expect = 0.93 Identities = 17/68 (25%), Positives = 32/68 (47%) Frame = -1 Query: 504 RFASVMVTCMLSFSQATVRESRAATAPGHDVVSDSDTAATVVPGKSVSGICLERAVASSA 325 +F +V+ C+ S S + R +P + + ++ KS+S C SA Sbjct: 130 KFNNVVQQCLESLSTVQIECLRRQPSPTMAFLDQLEAKMPLLSVKSISDACEMSGATHSA 189 Query: 324 LIINKHLI 301 L+I+K+L+ Sbjct: 190 LLIDKYLM 197 >SB_34706| Best HMM Match : Ion_trans_2 (HMM E-Value=2.1e-16) Length = 514 Score = 29.9 bits (64), Expect = 1.6 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +1 Query: 301 NEVFIDNKRAARDRAFQANPANRFTGN 381 +E +IDN + RD+ F A AN TGN Sbjct: 484 HESWIDNLKKLRDKQFNAANANHITGN 510 >SB_46345| Best HMM Match : AAA_5 (HMM E-Value=0.053) Length = 636 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = +2 Query: 113 HNKISSSVFPYTKQKTDTDYVYSSCAQRNVVLVCKHCVSCVFMCPKH 253 H+ I S V + KQ DT ++ + V ++CV V M P H Sbjct: 365 HHSILSPVVHHDKQCLDTQLMFDWLLPPSTDFVLRNCVGFVKMSPMH 411 >SB_9093| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = -1 Query: 336 ASSALIINKHLIFQSVFKFKS*ALKKPSCFGHIKTQDTQCLHTKTTF 196 +S A ++K L+F S+ ++ +L KPS F +++ LH + F Sbjct: 49 SSQAFSLHKPLVFTSLQSSQAFSLHKPSVFTSLQSSQAFSLHKPSVF 95 >SB_3579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 27.9 bits (59), Expect = 6.6 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +2 Query: 398 SESDTTSWPGAVAALDSLTVACEKDSMQVTITLAKRDPEINS 523 S+SDT WPG +A + S +A + + TL KR E+ + Sbjct: 233 SKSDTVPWPGMLAVVQSY-MAHKTAKEEERNTLLKRSEELKA 273 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 27.5 bits (58), Expect = 8.7 Identities = 16/35 (45%), Positives = 20/35 (57%) Frame = +3 Query: 426 APSLPWTLSPSPARKTACKSPLHWRNGTPKSIAST 530 A +L +LS SPA K +SPL + G PK I T Sbjct: 2798 ASNLKSSLSESPAEKEQVRSPLEFDPG-PKEIQKT 2831 >SB_31094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1183 Score = 27.5 bits (58), Expect = 8.7 Identities = 23/85 (27%), Positives = 41/85 (48%) Frame = +2 Query: 338 TARSKQIPLTDLPGTTVAAVSESDTTSWPGAVAALDSLTVACEKDSMQVTITLAKRDPEI 517 TA+S L++ SES +S +A SLT S Q++ + K P++ Sbjct: 995 TAQSLDSSLSERLVECAPTPSESGASSQALGSSAAPSLTEVATNSSGQLSSSFPKGLPDL 1054 Query: 518 NSIYDIFNGIVYPAGLGSNSSCLRE 592 ++ ++ +G+ L S+SS LR+ Sbjct: 1055 SASPNLPDGV---TSLSSSSSLLRD 1076 >SB_5609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 36 RAEFLQPGDPLV 1 R EFLQPGDPLV Sbjct: 31 RIEFLQPGDPLV 42 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,109,259 Number of Sequences: 59808 Number of extensions: 395936 Number of successful extensions: 1251 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1149 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1249 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -