BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0308 (640 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2674| Best HMM Match : Tubulin (HMM E-Value=0) 191 4e-49 SB_19437| Best HMM Match : Tubulin (HMM E-Value=0) 191 5e-49 SB_34400| Best HMM Match : Tubulin (HMM E-Value=0) 190 6e-49 SB_2003| Best HMM Match : Tubulin (HMM E-Value=0) 189 2e-48 SB_22193| Best HMM Match : No HMM Matches (HMM E-Value=.) 188 4e-48 SB_22191| Best HMM Match : No HMM Matches (HMM E-Value=.) 183 9e-47 SB_22190| Best HMM Match : No HMM Matches (HMM E-Value=.) 183 1e-46 SB_22192| Best HMM Match : No HMM Matches (HMM E-Value=.) 182 3e-46 SB_37573| Best HMM Match : No HMM Matches (HMM E-Value=.) 167 9e-42 SB_19567| Best HMM Match : No HMM Matches (HMM E-Value=.) 165 4e-41 SB_51156| Best HMM Match : Tubulin_C (HMM E-Value=0) 164 6e-41 SB_5512| Best HMM Match : Tubulin (HMM E-Value=0) 157 5e-39 SB_48961| Best HMM Match : Tubulin (HMM E-Value=0) 143 1e-34 SB_28561| Best HMM Match : No HMM Matches (HMM E-Value=.) 142 3e-34 SB_42897| Best HMM Match : No HMM Matches (HMM E-Value=.) 120 1e-27 SB_35594| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 5e-23 SB_17881| Best HMM Match : Tubulin (HMM E-Value=0) 93 1e-19 SB_47198| Best HMM Match : Tubulin (HMM E-Value=0) 93 2e-19 SB_47795| Best HMM Match : Tubulin_C (HMM E-Value=0.24) 93 2e-19 SB_39308| Best HMM Match : Tubulin (HMM E-Value=0) 91 5e-19 SB_17879| Best HMM Match : Tubulin (HMM E-Value=0) 90 2e-18 SB_48074| Best HMM Match : Tubulin (HMM E-Value=4.4e-27) 75 4e-14 SB_59740| Best HMM Match : Tubulin (HMM E-Value=2.1e-25) 64 1e-10 SB_25311| Best HMM Match : Tubulin (HMM E-Value=0) 55 6e-08 SB_18752| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_47142| Best HMM Match : Tubulin (HMM E-Value=5.32493e-44) 42 3e-04 SB_10843| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.085 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.34 SB_40336| Best HMM Match : Tubulin_C (HMM E-Value=1.3e-32) 32 0.34 SB_15838| Best HMM Match : Peptidase_A17 (HMM E-Value=7.9e-32) 32 0.34 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.45 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.45 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.79 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_32003| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 30 1.8 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_25359| Best HMM Match : p450 (HMM E-Value=0) 30 1.8 SB_18397| Best HMM Match : Peptidase_A17 (HMM E-Value=8.1e-32) 30 1.8 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_35488| Best HMM Match : Peptidase_A17 (HMM E-Value=8.1e-32) 30 1.8 SB_13703| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_11559| Best HMM Match : Peptidase_A17 (HMM E-Value=3.8e-33) 30 1.8 SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_5062| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_1533| Best HMM Match : RVT_1 (HMM E-Value=0.0074) 30 1.8 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_44084| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_2586| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_45701| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 29 3.2 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_29960| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_22214| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_34277| Best HMM Match : DUF321 (HMM E-Value=0.028) 28 5.6 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 28 5.6 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_1004| Best HMM Match : CPSase_sm_chain (HMM E-Value=0) 28 5.6 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_39410| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_30190| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) 28 5.6 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 28 7.4 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_24904| Best HMM Match : Op_neuropeptide (HMM E-Value=1.4) 28 7.4 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 28 7.4 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 28 7.4 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_12847| Best HMM Match : Ocnus (HMM E-Value=9.5) 28 7.4 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 28 7.4 SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) 28 7.4 SB_40987| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_39409| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_37019| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_36738| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_33340| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_30632| Best HMM Match : Acyltransferase (HMM E-Value=0.0097) 28 7.4 SB_30140| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_29661| Best HMM Match : DUF872 (HMM E-Value=8.6) 28 7.4 SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_22083| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_21616| Best HMM Match : RVT_1 (HMM E-Value=0.00011) 28 7.4 SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_9035| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_7708| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_4628| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_2728| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 28 7.4 SB_719| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 27 9.7 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_50612| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26) 27 9.7 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 27 9.7 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 27 9.7 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_36996| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_34798| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_33964| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_32543| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_30165| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_21711| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_15081| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 >SB_2674| Best HMM Match : Tubulin (HMM E-Value=0) Length = 1036 Score = 191 bits (466), Expect = 4e-49 Identities = 93/106 (87%), Positives = 93/106 (87%) Frame = +1 Query: 322 PGAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRI 501 P AVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRI Sbjct: 127 PRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRI 186 Query: 502 RKLADQCTGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKKSKLE 639 RKLADQCTGLQGFLIFH LLMERLSVDYGKKSKLE Sbjct: 187 RKLADQCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLE 232 Score = 190 bits (462), Expect = 1e-48 Identities = 90/106 (84%), Positives = 93/106 (87%) Frame = +1 Query: 322 PGAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRI 501 P AVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT+GKE++DLVLDRI Sbjct: 648 PRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKELIDLVLDRI 707 Query: 502 RKLADQCTGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKKSKLE 639 RKLADQCTGLQGFLIFH LLMERLSVDYGKKSKLE Sbjct: 708 RKLADQCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLE 753 Score = 145 bits (351), Expect = 3e-35 Identities = 63/66 (95%), Positives = 64/66 (96%) Frame = +3 Query: 129 IKMRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPTDKTIGGGDDSFNTFFSETGA 308 I RECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMP+DKTIGGGDDSFNTFFSETGA Sbjct: 63 ILQRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGA 122 Query: 309 GKHVPR 326 GKHVPR Sbjct: 123 GKHVPR 128 Score = 144 bits (349), Expect = 5e-35 Identities = 61/64 (95%), Positives = 64/64 (100%) Frame = +3 Query: 135 MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPTDKTIGGGDDSFNTFFSETGAGK 314 +RECIS+HVGQAGVQIGNACWELYCLEHGIQPDGQMP+DKTIGGGDDSFNTFFSETGAGK Sbjct: 586 VRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK 645 Query: 315 HVPR 326 HVPR Sbjct: 646 HVPR 649 Score = 144 bits (348), Expect = 7e-35 Identities = 61/63 (96%), Positives = 63/63 (100%) Frame = +3 Query: 138 RECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPTDKTIGGGDDSFNTFFSETGAGKH 317 RECIS+HVGQAGVQIGNACWELYCLEHGIQPDGQMP+DKTIGGGDDSFNTFFSETGAGKH Sbjct: 514 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKH 573 Query: 318 VPR 326 VPR Sbjct: 574 VPR 576 >SB_19437| Best HMM Match : Tubulin (HMM E-Value=0) Length = 885 Score = 191 bits (465), Expect = 5e-49 Identities = 92/106 (86%), Positives = 93/106 (87%) Frame = +1 Query: 322 PGAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRI 501 P AVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT+GKEIVDLVLDRI Sbjct: 496 PRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKEIVDLVLDRI 555 Query: 502 RKLADQCTGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKKSKLE 639 RKLADQCTGLQGFLIFH LLMERLSVDYGKKSKLE Sbjct: 556 RKLADQCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLE 601 Score = 190 bits (464), Expect = 6e-49 Identities = 91/106 (85%), Positives = 93/106 (87%) Frame = +1 Query: 322 PGAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRI 501 P AVFVDLEPTVVDEVRTGTYRQLFHPEQL+TGKEDAANNYARGHYT+GKEIVDLVLDRI Sbjct: 63 PRAVFVDLEPTVVDEVRTGTYRQLFHPEQLVTGKEDAANNYARGHYTVGKEIVDLVLDRI 122 Query: 502 RKLADQCTGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKKSKLE 639 RKLADQCTGLQGFLIFH LLMERLSVDYGKKSKLE Sbjct: 123 RKLADQCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLE 168 Score = 146 bits (353), Expect = 2e-35 Identities = 62/64 (96%), Positives = 64/64 (100%) Frame = +3 Query: 135 MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPTDKTIGGGDDSFNTFFSETGAGK 314 MRECIS+HVGQAGVQIGNACWELYCLEHGIQPDGQMP+DKTIGGGDDSFNTFFSETGAGK Sbjct: 1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK 60 Query: 315 HVPR 326 HVPR Sbjct: 61 HVPR 64 Score = 144 bits (348), Expect = 7e-35 Identities = 61/63 (96%), Positives = 63/63 (100%) Frame = +3 Query: 138 RECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPTDKTIGGGDDSFNTFFSETGAGKH 317 RECIS+HVGQAGVQIGNACWELYCLEHGIQPDGQMP+DKTIGGGDDSFNTFFSETGAGKH Sbjct: 435 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKH 494 Query: 318 VPR 326 VPR Sbjct: 495 VPR 497 >SB_34400| Best HMM Match : Tubulin (HMM E-Value=0) Length = 380 Score = 190 bits (464), Expect = 6e-49 Identities = 91/106 (85%), Positives = 93/106 (87%) Frame = +1 Query: 322 PGAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRI 501 P AVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT+GKEI+DLVLDRI Sbjct: 62 PRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKEIIDLVLDRI 121 Query: 502 RKLADQCTGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKKSKLE 639 RKLADQCTGLQGFLIFH LLMERLSVDYGKKSKLE Sbjct: 122 RKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLE 167 Score = 144 bits (348), Expect = 7e-35 Identities = 61/63 (96%), Positives = 63/63 (100%) Frame = +3 Query: 138 RECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPTDKTIGGGDDSFNTFFSETGAGKH 317 RECIS+HVGQAGVQIGNACWELYCLEHGIQPDGQMP+DKTIGGGDDSFNTFFSETGAGKH Sbjct: 1 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKH 60 Query: 318 VPR 326 VPR Sbjct: 61 VPR 63 >SB_2003| Best HMM Match : Tubulin (HMM E-Value=0) Length = 451 Score = 189 bits (460), Expect = 2e-48 Identities = 91/106 (85%), Positives = 92/106 (86%) Frame = +1 Query: 322 PGAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRI 501 P AVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEI+DLVLDR Sbjct: 63 PRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRC 122 Query: 502 RKLADQCTGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKKSKLE 639 RKLADQCTGLQGFLIFH LLMERLSVDYGKKSKLE Sbjct: 123 RKLADQCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLE 168 Score = 144 bits (350), Expect = 4e-35 Identities = 61/64 (95%), Positives = 64/64 (100%) Frame = +3 Query: 135 MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPTDKTIGGGDDSFNTFFSETGAGK 314 MRECIS+HVGQAGVQ+GNACWELYCLEHGIQPDGQMP+DKTIGGGDDSFNTFFSETGAGK Sbjct: 1 MRECISIHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK 60 Query: 315 HVPR 326 HVPR Sbjct: 61 HVPR 64 >SB_22193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1231 Score = 188 bits (457), Expect = 4e-48 Identities = 89/106 (83%), Positives = 92/106 (86%) Frame = +1 Query: 322 PGAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRI 501 P AVF DLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT+GKE++DLVLDRI Sbjct: 867 PRAVFADLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKEMIDLVLDRI 926 Query: 502 RKLADQCTGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKKSKLE 639 RKLADQCTGLQGFLIFH LLMERLSVDYGKKSKLE Sbjct: 927 RKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLE 972 Score = 183 bits (445), Expect = 1e-46 Identities = 86/106 (81%), Positives = 91/106 (85%) Frame = +1 Query: 322 PGAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRI 501 P AVFVDLEPTV+DEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT+GKE +D+VLDR+ Sbjct: 434 PRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKEQIDIVLDRL 493 Query: 502 RKLADQCTGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKKSKLE 639 RKLAD CTGLQGFLIFH LLMERLSVDYGKKSKLE Sbjct: 494 RKLADGCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLE 539 Score = 143 bits (346), Expect = 1e-34 Identities = 61/63 (96%), Positives = 63/63 (100%) Frame = +3 Query: 138 RECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPTDKTIGGGDDSFNTFFSETGAGKH 317 RECISVHVGQAGVQ+GNACWELYCLEHGIQPDGQMP+DKTIGGGDDSFNTFFSETGAGKH Sbjct: 806 RECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKH 865 Query: 318 VPR 326 VPR Sbjct: 866 VPR 868 Score = 141 bits (342), Expect = 4e-34 Identities = 59/63 (93%), Positives = 63/63 (100%) Frame = +3 Query: 138 RECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPTDKTIGGGDDSFNTFFSETGAGKH 317 RECIS+HVGQAGVQIGNACWELYCLEHGIQPDGQMP+DKTIGGGDD+FNTFF+ETGAGKH Sbjct: 373 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFAETGAGKH 432 Query: 318 VPR 326 VPR Sbjct: 433 VPR 435 >SB_22191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 865 Score = 183 bits (446), Expect = 9e-47 Identities = 85/106 (80%), Positives = 92/106 (86%) Frame = +1 Query: 322 PGAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRI 501 P AVF DLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT+GK+++++VLDR+ Sbjct: 48 PRAVFCDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKQLIEIVLDRL 107 Query: 502 RKLADQCTGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKKSKLE 639 RKLADQCTGLQGFLIFH LLMERLSVDYGKKSKLE Sbjct: 108 RKLADQCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLE 153 Score = 178 bits (433), Expect = 4e-45 Identities = 82/106 (77%), Positives = 91/106 (85%) Frame = +1 Query: 322 PGAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRI 501 P AVFVDLEP+V+DE+RTGTYRQLFHPEQLITGKEDAANNYARGHYT+GK+ +D VLDRI Sbjct: 481 PRAVFVDLEPSVIDEIRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKDHIDNVLDRI 540 Query: 502 RKLADQCTGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKKSKLE 639 RKLADQC+GLQGFL+FH LL+ERLSVDYGKKSKLE Sbjct: 541 RKLADQCSGLQGFLVFHSFGGGTGSGFSALLLERLSVDYGKKSKLE 586 Score = 142 bits (344), Expect = 2e-34 Identities = 59/63 (93%), Positives = 63/63 (100%) Frame = +3 Query: 138 RECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPTDKTIGGGDDSFNTFFSETGAGKH 317 REC+S+HVGQAGVQ+GNACWELYCLEHGIQPDGQMP+DKTIGGGDDSFNTFFSETGAGKH Sbjct: 420 RECVSIHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKH 479 Query: 318 VPR 326 VPR Sbjct: 480 VPR 482 Score = 113 bits (273), Expect = 9e-26 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = +3 Query: 180 IGNACWELYCLEHGIQPDGQMPTDKTIGGGDDSFNTFFSETGAGKHVPR 326 +GNACWELYCLEHGIQPDGQMP+DKTIGGGDDSFNTFFSETGAGKHVPR Sbjct: 1 MGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPR 49 >SB_22190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 417 Score = 183 bits (445), Expect = 1e-46 Identities = 85/106 (80%), Positives = 91/106 (85%) Frame = +1 Query: 322 PGAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRI 501 P AVFVDLEPTV+DE+RTGTYRQLFHPEQL++GKEDAANNYARGHYT+GKE +DL LDRI Sbjct: 28 PRAVFVDLEPTVIDEIRTGTYRQLFHPEQLLSGKEDAANNYARGHYTVGKEHIDLALDRI 87 Query: 502 RKLADQCTGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKKSKLE 639 RKLADQCTGLQGFLIFH LLMERLSVDYGKKSKLE Sbjct: 88 RKLADQCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLE 133 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +3 Query: 240 MPTDKTIGGGDDSFNTFFSETGAGKHVPR 326 MP+DKTIGGGDDSFNTFF+ETGAGKHVPR Sbjct: 1 MPSDKTIGGGDDSFNTFFAETGAGKHVPR 29 >SB_22192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 452 Score = 182 bits (442), Expect = 3e-46 Identities = 86/106 (81%), Positives = 90/106 (84%) Frame = +1 Query: 322 PGAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRI 501 P AVF DLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT+GKE++D VLDR+ Sbjct: 63 PRAVFCDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKEMIDTVLDRL 122 Query: 502 RKLADQCTGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKKSKLE 639 RKLAD CTGLQGFLIFH LLMERLSVDYGKKSKLE Sbjct: 123 RKLADGCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLE 168 Score = 144 bits (348), Expect = 7e-35 Identities = 61/64 (95%), Positives = 64/64 (100%) Frame = +3 Query: 135 MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPTDKTIGGGDDSFNTFFSETGAGK 314 MRECISVHVGQAGVQ+GNACWELYCLEHGIQPDGQMP+DKTIGGGDDSFNTFFSETG+GK Sbjct: 1 MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGSGK 60 Query: 315 HVPR 326 HVPR Sbjct: 61 HVPR 64 >SB_37573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 167 bits (405), Expect = 9e-42 Identities = 78/95 (82%), Positives = 82/95 (86%) Frame = +1 Query: 355 VVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQ 534 + DEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT+GKE++DLVLDRIRKLADQCTGLQ Sbjct: 11 LADEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKELIDLVLDRIRKLADQCTGLQ 70 Query: 535 GFLIFHXXXXXXXXXXXXLLMERLSVDYGKKSKLE 639 GFLIFH LLMERLSVDYGKKSKLE Sbjct: 71 GFLIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLE 105 >SB_19567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1383 Score = 165 bits (400), Expect = 4e-41 Identities = 75/106 (70%), Positives = 87/106 (82%) Frame = +1 Query: 322 PGAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRI 501 P AV VDLEPTV+DEVRTG YR L+HPEQ+I+GKEDAANNYARGHYTIGKE+V++V+D+I Sbjct: 974 PRAVLVDLEPTVIDEVRTGMYRYLYHPEQMISGKEDAANNYARGHYTIGKEMVEVVMDKI 1033 Query: 502 RKLADQCTGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKKSKLE 639 RK+ DQC+GLQGFLIFH L+ E LSVDYGKKSKLE Sbjct: 1034 RKMTDQCSGLQGFLIFHSFGGGTGSGFASLITEHLSVDYGKKSKLE 1079 >SB_51156| Best HMM Match : Tubulin_C (HMM E-Value=0) Length = 377 Score = 164 bits (398), Expect = 6e-41 Identities = 77/92 (83%), Positives = 80/92 (86%) Frame = +1 Query: 364 EVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFL 543 EVRTGTYRQLFHPEQLITGKEDAANNYARGHYT+GKE++DLVLDRIRKLADQCTGLQGFL Sbjct: 2 EVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKELIDLVLDRIRKLADQCTGLQGFL 61 Query: 544 IFHXXXXXXXXXXXXLLMERLSVDYGKKSKLE 639 IFH LLMERLSVDYGKKSKLE Sbjct: 62 IFHSFGGGTGSGFSSLLMERLSVDYGKKSKLE 93 >SB_5512| Best HMM Match : Tubulin (HMM E-Value=0) Length = 365 Score = 157 bits (382), Expect = 5e-39 Identities = 73/92 (79%), Positives = 78/92 (84%) Frame = +1 Query: 364 EVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFL 543 E+RTGTYRQLFHPEQL++GKEDAANNYARGHYT+GKE +DL LDRIRKLADQCTGLQGFL Sbjct: 2 EIRTGTYRQLFHPEQLLSGKEDAANNYARGHYTVGKEHIDLALDRIRKLADQCTGLQGFL 61 Query: 544 IFHXXXXXXXXXXXXLLMERLSVDYGKKSKLE 639 IFH LLMERLSVDYGKKSKLE Sbjct: 62 IFHSFGGGTGSGFSSLLMERLSVDYGKKSKLE 93 >SB_48961| Best HMM Match : Tubulin (HMM E-Value=0) Length = 536 Score = 143 bits (346), Expect = 1e-34 Identities = 61/64 (95%), Positives = 63/64 (98%) Frame = +3 Query: 135 MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPTDKTIGGGDDSFNTFFSETGAGK 314 MRECIS+HVGQAGVQIGNACWELYCLEHGIQPDGQMP+DKT GGGDDSFNTFFSETGAGK Sbjct: 1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTQGGGDDSFNTFFSETGAGK 60 Query: 315 HVPR 326 HVPR Sbjct: 61 HVPR 64 Score = 140 bits (338), Expect = 1e-33 Identities = 74/106 (69%), Positives = 77/106 (72%) Frame = +1 Query: 322 PGAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRI 501 P AVFVDLEPTVV PEQLITGKEDAANNYARGHYTIGK+ VD VLDR+ Sbjct: 63 PRAVFVDLEPTVV----------ALSPEQLITGKEDAANNYARGHYTIGKQQVDQVLDRL 112 Query: 502 RKLADQCTGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKKSKLE 639 RKLADQC+GLQGF IFH LLMERLSVDYGKKSKLE Sbjct: 113 RKLADQCSGLQGFFIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLE 158 >SB_28561| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 142 bits (343), Expect = 3e-34 Identities = 61/64 (95%), Positives = 62/64 (96%) Frame = +3 Query: 135 MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPTDKTIGGGDDSFNTFFSETGAGK 314 MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMP+DKTI GGDDSFNTFFSETG GK Sbjct: 1 MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIDGGDDSFNTFFSETGGGK 60 Query: 315 HVPR 326 HVPR Sbjct: 61 HVPR 64 >SB_42897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 120 bits (288), Expect = 1e-27 Identities = 49/65 (75%), Positives = 57/65 (87%) Frame = +3 Query: 135 MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPTDKTIGGGDDSFNTFFSETGAGK 314 MREC+S+HVGQAGVQIGNACWELYCLEHGIQPDG MP+D++ DDSF+TFFSET +GK Sbjct: 196 MRECLSIHVGQAGVQIGNACWELYCLEHGIQPDGHMPSDQSADRCDDSFSTFFSETASGK 255 Query: 315 HVPRC 329 H +C Sbjct: 256 HADQC 260 Score = 62.9 bits (146), Expect = 2e-10 Identities = 30/45 (66%), Positives = 32/45 (71%) Frame = +1 Query: 505 KLADQCTGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKKSKLE 639 K ADQCTGLQGFL+FH LLMERLSVDYGK+SKLE Sbjct: 255 KHADQCTGLQGFLVFHSFGGGTGSGFSSLLMERLSVDYGKRSKLE 299 >SB_35594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 104 bits (250), Expect = 5e-23 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = +1 Query: 364 EVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKL 510 EVRTGTYRQLFHPEQLITGKEDAANNYARGHYT+GKE++DLVLDRIRKL Sbjct: 2 EVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKELIDLVLDRIRKL 50 >SB_17881| Best HMM Match : Tubulin (HMM E-Value=0) Length = 458 Score = 93.5 bits (222), Expect = 1e-19 Identities = 43/99 (43%), Positives = 60/99 (60%) Frame = +1 Query: 322 PGAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRI 501 P AV VDLEP +D VR+G + Q+F P+ + G+ A NN+A+GHYT G E+VD VLD + Sbjct: 274 PRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV 333 Query: 502 RKLADQCTGLQGFLIFHXXXXXXXXXXXXLLMERLSVDY 618 RK A+ C LQGF + H LL+ ++ +Y Sbjct: 334 RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEY 372 Score = 52.8 bits (121), Expect = 2e-07 Identities = 27/68 (39%), Positives = 35/68 (51%) Frame = +3 Query: 132 KMRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPTDKTIGGGDDSFNTFFSETGAG 311 KMRE + GQ G QIG WE+ EHGI P G D + + N +++E G Sbjct: 213 KMREIVHCQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL--QLERINVYYNEATGG 270 Query: 312 KHVPRCCL 335 K+VPR L Sbjct: 271 KYVPRAVL 278 >SB_47198| Best HMM Match : Tubulin (HMM E-Value=0) Length = 446 Score = 93.1 bits (221), Expect = 2e-19 Identities = 42/99 (42%), Positives = 60/99 (60%) Frame = +1 Query: 322 PGAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRI 501 P A+ VDLEP +D VR+G + Q+F P+ + G+ A NN+A+GHYT G E+VD VLD + Sbjct: 61 PRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV 120 Query: 502 RKLADQCTGLQGFLIFHXXXXXXXXXXXXLLMERLSVDY 618 RK A+ C LQGF + H LL+ ++ +Y Sbjct: 121 RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEY 159 Score = 50.8 bits (116), Expect = 9e-07 Identities = 26/67 (38%), Positives = 34/67 (50%) Frame = +3 Query: 135 MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPTDKTIGGGDDSFNTFFSETGAGK 314 MRE + GQ G QIG WE+ EHGI P G D + + N +++E GK Sbjct: 1 MREIVHCQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL--QLERINVYYNEATGGK 58 Query: 315 HVPRCCL 335 +VPR L Sbjct: 59 YVPRAIL 65 >SB_47795| Best HMM Match : Tubulin_C (HMM E-Value=0.24) Length = 149 Score = 92.7 bits (220), Expect = 2e-19 Identities = 40/49 (81%), Positives = 45/49 (91%) Frame = +1 Query: 364 EVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKL 510 EVR GTYR LFHP+QLITGKEDAANNYARGHYT+GKE +DL L++IRKL Sbjct: 2 EVRMGTYRDLFHPDQLITGKEDAANNYARGHYTVGKEHIDLTLEKIRKL 50 >SB_39308| Best HMM Match : Tubulin (HMM E-Value=0) Length = 391 Score = 91.5 bits (217), Expect = 5e-19 Identities = 42/99 (42%), Positives = 60/99 (60%) Frame = +1 Query: 322 PGAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRI 501 P AV VDLEP +D VR+G + Q+F P+ + G+ A NN+A+GHYT G E+VD VLD + Sbjct: 6 PRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV 65 Query: 502 RKLADQCTGLQGFLIFHXXXXXXXXXXXXLLMERLSVDY 618 RK A+ C +QGF + H LL+ ++ +Y Sbjct: 66 RKEAESCDCIQGFQLTHSLGGGTGSGMVTLLILKIREEY 104 >SB_17879| Best HMM Match : Tubulin (HMM E-Value=0) Length = 446 Score = 89.8 bits (213), Expect = 2e-18 Identities = 39/99 (39%), Positives = 60/99 (60%) Frame = +1 Query: 322 PGAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRI 501 P +V +DLEP +D VR+G + Q+F P+ + G+ A NN+A+GHYT G E++D VLD + Sbjct: 61 PRSVLIDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELMDSVLDVV 120 Query: 502 RKLADQCTGLQGFLIFHXXXXXXXXXXXXLLMERLSVDY 618 RK A+ C +QGF + H LL+ ++ +Y Sbjct: 121 RKEAESCDCIQGFQLTHSLGGGTGSGMGTLLISKIREEY 159 Score = 53.2 bits (122), Expect = 2e-07 Identities = 27/67 (40%), Positives = 36/67 (53%) Frame = +3 Query: 135 MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPTDKTIGGGDDSFNTFFSETGAGK 314 MRE +S+ GQ G QIG WE+ EHGI P G D + + N +++E GK Sbjct: 1 MREIVSLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL--QLERINVYYNEATGGK 58 Query: 315 HVPRCCL 335 +VPR L Sbjct: 59 YVPRSVL 65 >SB_48074| Best HMM Match : Tubulin (HMM E-Value=4.4e-27) Length = 144 Score = 75.4 bits (177), Expect = 4e-14 Identities = 32/99 (32%), Positives = 54/99 (54%) Frame = +1 Query: 322 PGAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRI 501 P ++ VDLEP +D VR G +F P+ + + AANN+A+GHY+ G E++D + D + Sbjct: 17 PRSILVDLEPGTMDAVRGGPLGNMFRPDNFVNSQSGAANNWAKGHYSEGAELIDNIFDVL 76 Query: 502 RKLADQCTGLQGFLIFHXXXXXXXXXXXXLLMERLSVDY 618 RK A+ C +QG + L++ ++ +Y Sbjct: 77 RKEAENCDCMQGVQLIQALGGGTGSGLGTLILSKIREEY 115 >SB_59740| Best HMM Match : Tubulin (HMM E-Value=2.1e-25) Length = 139 Score = 63.7 bits (148), Expect = 1e-10 Identities = 31/43 (72%), Positives = 31/43 (72%) Frame = +1 Query: 511 ADQCTGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKKSKLE 639 ADQCTGLQGFLIFH LLMERLSVDYGKKSKLE Sbjct: 1 ADQCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLE 43 >SB_25311| Best HMM Match : Tubulin (HMM E-Value=0) Length = 629 Score = 54.8 bits (126), Expect = 6e-08 Identities = 26/66 (39%), Positives = 38/66 (57%) Frame = +1 Query: 421 KEDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHXXXXXXXXXXXXLLME 600 + AANN+A+G YT G E++D +D IRKLA+ C +QGF I H LL+ Sbjct: 2 QNSAANNWAKGFYTEGAELMDSGMDCIRKLAENCDTVQGFQIAHSLGGGTGSGLGSLLLS 61 Query: 601 RLSVDY 618 ++ +Y Sbjct: 62 KIREEY 67 >SB_18752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 50.8 bits (116), Expect = 9e-07 Identities = 26/67 (38%), Positives = 34/67 (50%) Frame = +3 Query: 135 MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPTDKTIGGGDDSFNTFFSETGAGK 314 MRE + GQ G QIG WE+ EHGI P G D + + N +++E GK Sbjct: 1 MREIVHCQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL--QLERINVYYNEATGGK 58 Query: 315 HVPRCCL 335 +VPR L Sbjct: 59 YVPRAIL 65 Score = 37.9 bits (84), Expect = 0.007 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = +1 Query: 322 PGAVFVDLEPTVVDEVRTGTYRQLFHPEQLI 414 P A+ VDLEP +D VR+G + Q+F P+ + Sbjct: 61 PRAILVDLEPGTMDSVRSGPFGQIFRPDNFV 91 >SB_47142| Best HMM Match : Tubulin (HMM E-Value=5.32493e-44) Length = 474 Score = 42.3 bits (95), Expect = 3e-04 Identities = 24/77 (31%), Positives = 42/77 (54%), Gaps = 5/77 (6%) Frame = +1 Query: 328 AVFVDLEPTVVDEV-----RTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVL 492 AV +D+E V+ + ++GT+R + Q + K + NN+A G G + +D VL Sbjct: 68 AVSIDMESKVISQTLSEASKSGTWR--YPKGQQFSQKRGSGNNWAHGFSEHGPKSIDKVL 125 Query: 493 DRIRKLADQCTGLQGFL 543 D +++ ++C L GFL Sbjct: 126 DLVQREVEKCDRLDGFL 142 >SB_10843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1259 Score = 34.3 bits (75), Expect = 0.085 Identities = 22/66 (33%), Positives = 29/66 (43%) Frame = +1 Query: 169 PESRSVMPAGSFTAWSTASSLMARCPQTRPSGVETILSTLSSARPELASTYPGAVFVDLE 348 P S S + WS +SL R P S LS L+ + EL T PG + V + Sbjct: 532 PGSASASLLSYPSTWSDRASLYDRIPARFSSSRSESLSDLTDSEQELDKTTPGIIPVIVG 591 Query: 349 PTVVDE 366 P V D+ Sbjct: 592 PEVADD 597 >SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 33.5 bits (73), Expect = 0.15 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -3 Query: 86 SVVVQRDRLSGSCSPGDPLV 27 S+V QR R S SCSPGDPLV Sbjct: 14 SIVGQRRRESNSCSPGDPLV 33 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 32.7 bits (71), Expect = 0.26 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = -3 Query: 80 VVQRDRLSGSCSPGDPLV 27 +++ DR+S SCSPGDPLV Sbjct: 1 MIKSDRVSNSCSPGDPLV 18 >SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 32.7 bits (71), Expect = 0.26 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -3 Query: 77 VQRDRLSGSCSPGDPLV 27 V RD +S SCSPGDPLV Sbjct: 10 VNRDEVSNSCSPGDPLV 26 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 32.3 bits (70), Expect = 0.34 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 68 DRLSGSCSPGDPLV 27 DRLS SCSPGDPLV Sbjct: 22 DRLSNSCSPGDPLV 35 >SB_40336| Best HMM Match : Tubulin_C (HMM E-Value=1.3e-32) Length = 488 Score = 32.3 bits (70), Expect = 0.34 Identities = 15/53 (28%), Positives = 28/53 (52%) Frame = +1 Query: 286 LSSARPELASTYPGAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNY 444 + +++ ++ S AV +D+E VV+ + G +F +QLIT NN+ Sbjct: 63 VGNSKGKIKSLKARAVLIDMEEGVVNNILKGPLHDVFDCQQLITDVSGCGNNW 115 >SB_15838| Best HMM Match : Peptidase_A17 (HMM E-Value=7.9e-32) Length = 1027 Score = 32.3 bits (70), Expect = 0.34 Identities = 21/64 (32%), Positives = 32/64 (50%) Frame = +1 Query: 280 STLSSARPELASTYPGAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHY 459 +TL + YP V+ L T VD+V+TG PEQL+ K++A+ RG + Sbjct: 112 ATLQKHVASYSDKYPETVYQLLTNTYVDDVQTGG----DDPEQLLRFKQEASEIMERGGF 167 Query: 460 TIGK 471 + K Sbjct: 168 QLHK 171 >SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 31.9 bits (69), Expect = 0.45 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = -3 Query: 143 LTHFDSTSFSMLKCRIKL*SVVVQRDRLSGSCSPGDPLV 27 + HF T S CR++ S SCSPGDPLV Sbjct: 1 MKHFTDTLISANICRVRTQIAEKHVKFTSNSCSPGDPLV 39 >SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 31.9 bits (69), Expect = 0.45 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = -3 Query: 80 VVQRDRLSGSCSPGDPLV 27 ++Q+ ++S SCSPGDPLV Sbjct: 62 IIQKIKISNSCSPGDPLV 79 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 31.1 bits (67), Expect = 0.79 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -3 Query: 83 VVVQRDRLSGSCSPGDPLV 27 + V D +S SCSPGDPLV Sbjct: 4 IFVSNDAVSNSCSPGDPLV 22 >SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 30.7 bits (66), Expect = 1.0 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -3 Query: 95 KL*SVVVQRDRLSGSCSPGDPLV 27 K+ +V R S SCSPGDPLV Sbjct: 41 KIHKIVKSSSRASNSCSPGDPLV 63 >SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 30.7 bits (66), Expect = 1.0 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -3 Query: 86 SVVVQRDRLSGSCSPGDPLV 27 +++ R LS SCSPGDPLV Sbjct: 12 NIICSRTVLSNSCSPGDPLV 31 >SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 30.7 bits (66), Expect = 1.0 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 74 QRDRLSGSCSPGDPLV 27 QR R S SCSPGDPLV Sbjct: 14 QRPRESNSCSPGDPLV 29 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 30.3 bits (65), Expect = 1.4 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = -3 Query: 77 VQRDRLSGSCSPGDPLV 27 V R LS SCSPGDPLV Sbjct: 58 VSRTLLSNSCSPGDPLV 74 >SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 30.3 bits (65), Expect = 1.4 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 71 RDRLSGSCSPGDPLV 27 RD+ S SCSPGDPLV Sbjct: 107 RDQRSNSCSPGDPLV 121 >SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 30.3 bits (65), Expect = 1.4 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 3/42 (7%) Frame = -3 Query: 143 LTHFDST--SFSMLKCRIKL*SV-VVQRDRLSGSCSPGDPLV 27 + HF T S ++L C +L + +R S SCSPGDPLV Sbjct: 1 MKHFTDTLISANILYCNKQLVIIRATRRKPQSNSCSPGDPLV 42 >SB_32003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 30.3 bits (65), Expect = 1.4 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -3 Query: 68 DRLSGSCSPGDPLV 27 DR S SCSPGDPLV Sbjct: 10 DRTSNSCSPGDPLV 23 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 29.9 bits (64), Expect = 1.8 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -3 Query: 68 DRLSGSCSPGDPLV 27 DR S SCSPGDPLV Sbjct: 379 DRRSNSCSPGDPLV 392 >SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 29.9 bits (64), Expect = 1.8 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -3 Query: 68 DRLSGSCSPGDPLV 27 D LS SCSPGDPLV Sbjct: 6 DTLSNSCSPGDPLV 19 >SB_25359| Best HMM Match : p450 (HMM E-Value=0) Length = 1084 Score = 29.9 bits (64), Expect = 1.8 Identities = 20/64 (31%), Positives = 31/64 (48%) Frame = +1 Query: 280 STLSSARPELASTYPGAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHY 459 +TL + YP V+ L T VD+V+TG PEQL+ K++A+ G + Sbjct: 140 ATLQKHVASYSDKYPETVYQLLTNTYVDDVQTGG----DDPEQLLRFKQEASEIMESGGF 195 Query: 460 TIGK 471 + K Sbjct: 196 QLHK 199 >SB_18397| Best HMM Match : Peptidase_A17 (HMM E-Value=8.1e-32) Length = 1626 Score = 29.9 bits (64), Expect = 1.8 Identities = 20/64 (31%), Positives = 31/64 (48%) Frame = +1 Query: 280 STLSSARPELASTYPGAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHY 459 +TL + YP V+ L T VD+V+TG PEQL+ K++A+ G + Sbjct: 753 ATLQKHVASYSDKYPETVYQLLTNTYVDDVQTGG----DDPEQLLRFKQEASEIMESGGF 808 Query: 460 TIGK 471 + K Sbjct: 809 QLHK 812 >SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 29.9 bits (64), Expect = 1.8 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = -3 Query: 77 VQRDRLSGSCSPGDPLV 27 V R R S SCSPGDPLV Sbjct: 97 VTRIRTSNSCSPGDPLV 113 >SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 29.9 bits (64), Expect = 1.8 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -3 Query: 116 SMLKCRIKL*SVVVQRDRLSGSCSPGDPLV 27 + LK +I +++Q S SCSPGDPLV Sbjct: 51 TQLKTQIDTFILILQPHPRSNSCSPGDPLV 80 >SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 29.9 bits (64), Expect = 1.8 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -3 Query: 104 CRIKL*SVVVQRDRLSGSCSPGDPLV 27 C ++ S++ LS SCSPGDPLV Sbjct: 9 CAVRDTSILSAGRSLSNSCSPGDPLV 34 >SB_35488| Best HMM Match : Peptidase_A17 (HMM E-Value=8.1e-32) Length = 1019 Score = 29.9 bits (64), Expect = 1.8 Identities = 20/64 (31%), Positives = 31/64 (48%) Frame = +1 Query: 280 STLSSARPELASTYPGAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHY 459 +TL + YP V+ L T VD+V+TG PEQL+ K++A+ G + Sbjct: 432 ATLQKHVASYSDKYPETVYQLLTNTYVDDVQTGG----DDPEQLLRFKQEASEIMESGGF 487 Query: 460 TIGK 471 + K Sbjct: 488 QLHK 491 >SB_13703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1358 Score = 29.9 bits (64), Expect = 1.8 Identities = 20/64 (31%), Positives = 31/64 (48%) Frame = +1 Query: 280 STLSSARPELASTYPGAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHY 459 +TL + YP V+ L T VD+V+TG PEQL+ K++A+ G + Sbjct: 476 ATLQKHVASYSDKYPETVYQLLTNTYVDDVQTGG----DDPEQLLRFKQEASEIMESGGF 531 Query: 460 TIGK 471 + K Sbjct: 532 QLHK 535 >SB_11559| Best HMM Match : Peptidase_A17 (HMM E-Value=3.8e-33) Length = 1485 Score = 29.9 bits (64), Expect = 1.8 Identities = 20/64 (31%), Positives = 31/64 (48%) Frame = +1 Query: 280 STLSSARPELASTYPGAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHY 459 +TL + YP V+ L T VD+V+TG PEQL+ K++A+ G + Sbjct: 666 ATLQKHVASYSDKYPETVYQLLTNTYVDDVQTGG----DDPEQLLRFKQEASEIMESGGF 721 Query: 460 TIGK 471 + K Sbjct: 722 QLHK 725 >SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 29.9 bits (64), Expect = 1.8 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -3 Query: 68 DRLSGSCSPGDPLV 27 DR S SCSPGDPLV Sbjct: 6 DRRSNSCSPGDPLV 19 >SB_5062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.9 bits (64), Expect = 1.8 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -3 Query: 65 RLSGSCSPGDPLV 27 RLS SCSPGDPLV Sbjct: 13 RLSNSCSPGDPLV 25 >SB_1533| Best HMM Match : RVT_1 (HMM E-Value=0.0074) Length = 503 Score = 29.9 bits (64), Expect = 1.8 Identities = 20/64 (31%), Positives = 31/64 (48%) Frame = +1 Query: 280 STLSSARPELASTYPGAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHY 459 +TL + YP V+ L T VD+V+TG PEQL+ K++A+ G + Sbjct: 356 ATLQKHVASYSDKYPETVYQLLTNTYVDDVQTGG----DDPEQLLRFKQEASEIMESGGF 411 Query: 460 TIGK 471 + K Sbjct: 412 QLHK 415 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 29.5 bits (63), Expect = 2.4 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 74 QRDRLSGSCSPGDPLV 27 Q++ +S SCSPGDPLV Sbjct: 116 QKEIISNSCSPGDPLV 131 >SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 29.5 bits (63), Expect = 2.4 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -3 Query: 77 VQRDRLSGSCSPGDPLV 27 ++R R S SCSPGDPLV Sbjct: 72 IKRYRESNSCSPGDPLV 88 >SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.5 bits (63), Expect = 2.4 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = -3 Query: 86 SVVVQRDRLSGSCSPGDPLV 27 +++ +++ S SCSPGDPLV Sbjct: 13 NIITLQEKKSNSCSPGDPLV 32 >SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.5 bits (63), Expect = 2.4 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 68 DRLSGSCSPGDPLV 27 D +S SCSPGDPLV Sbjct: 5 DEISNSCSPGDPLV 18 >SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.5 bits (63), Expect = 2.4 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -3 Query: 68 DRLSGSCSPGDPLV 27 D LS SCSPGDPLV Sbjct: 4 DDLSNSCSPGDPLV 17 >SB_44084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -3 Query: 86 SVVVQRDRLSGSCSPGDPLV 27 S+V R S SCSPGDPLV Sbjct: 27 SLVYYRSITSNSCSPGDPLV 46 >SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -3 Query: 86 SVVVQRDRLSGSCSPGDPLV 27 S + +R LS SCSPGDPLV Sbjct: 6 SELEKRQVLSNSCSPGDPLV 25 >SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.5 bits (63), Expect = 2.4 Identities = 15/27 (55%), Positives = 18/27 (66%) Frame = -3 Query: 107 KCRIKL*SVVVQRDRLSGSCSPGDPLV 27 K ++ L SV D +S SCSPGDPLV Sbjct: 2 KIQLYLVSVDKIADFVSNSCSPGDPLV 28 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.1 bits (62), Expect = 3.2 Identities = 14/18 (77%), Positives = 15/18 (83%), Gaps = 1/18 (5%) Frame = -3 Query: 77 VQRDRL-SGSCSPGDPLV 27 VQR R+ S SCSPGDPLV Sbjct: 12 VQRFRIISNSCSPGDPLV 29 >SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -3 Query: 77 VQRDRLSGSCSPGDPLV 27 +QR S SCSPGDPLV Sbjct: 61 LQRQGRSNSCSPGDPLV 77 >SB_2586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 38 Score = 29.1 bits (62), Expect = 3.2 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +3 Query: 195 WELYCLEHGIQPDGQMPTDKTIGGGDDSFNTFFSE 299 WE+ EHGI PDGQ T D N +F E Sbjct: 2 WEVIAEEHGIDPDGQC-TAVQSKIQTDRLNVYFDE 35 >SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 29.1 bits (62), Expect = 3.2 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 74 QRDRLSGSCSPGDPLV 27 ++ R S SCSPGDPLV Sbjct: 4 EKSRRSNSCSPGDPLV 19 >SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 29.1 bits (62), Expect = 3.2 Identities = 16/41 (39%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = -3 Query: 143 LTHFDSTSFSM-LKC-RIKL*SVVVQRDRLSGSCSPGDPLV 27 + HF T S + C +I++ ++++ + S SCSPGDPLV Sbjct: 1 MKHFTDTLISANIHCEKIQISNILIPKIA-SNSCSPGDPLV 40 >SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 29.1 bits (62), Expect = 3.2 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -3 Query: 80 VVQRDRLSGSCSPGDPLV 27 + + +LS SCSPGDPLV Sbjct: 1 MAKNSQLSNSCSPGDPLV 18 >SB_45701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 326 Score = 29.1 bits (62), Expect = 3.2 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = -2 Query: 270 LHPRWSCLWASGHQAGCRAPGSKAPSRHYRSGLRLGQ 160 LH ++S L+ G +G ++PG AP RH R+ RL Q Sbjct: 32 LHFQYSGLYG-GVDSGKQSPGVMAPPRHSRNRNRLSQ 67 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.1 bits (62), Expect = 3.2 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 65 RLSGSCSPGDPLV 27 R+S SCSPGDPLV Sbjct: 31 RISNSCSPGDPLV 43 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 29.1 bits (62), Expect = 3.2 Identities = 16/39 (41%), Positives = 22/39 (56%) Frame = -3 Query: 143 LTHFDSTSFSMLKCRIKL*SVVVQRDRLSGSCSPGDPLV 27 + HF T S RI + ++ + +S SCSPGDPLV Sbjct: 1 MKHFTDTLISA-NIRISVLALKSRPMLVSNSCSPGDPLV 38 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 29.1 bits (62), Expect = 3.2 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = +2 Query: 26 KLVDPPGCRSHLTG 67 +LVDPPGCR+ +TG Sbjct: 101 ELVDPPGCRNSITG 114 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 65 RLSGSCSPGDPLV 27 +LS SCSPGDPLV Sbjct: 61 KLSNSCSPGDPLV 73 >SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -3 Query: 77 VQRDRLSGSCSPGDPLV 27 +Q+ S SCSPGDPLV Sbjct: 37 LQKKNASNSCSPGDPLV 53 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 68 DRLSGSCSPGDPLV 27 D +S SCSPGDPLV Sbjct: 36 DLISNSCSPGDPLV 49 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 65 RLSGSCSPGDPLV 27 R+S SCSPGDPLV Sbjct: 39 RVSNSCSPGDPLV 51 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 65 RLSGSCSPGDPLV 27 R+S SCSPGDPLV Sbjct: 183 RVSNSCSPGDPLV 195 >SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 65 RLSGSCSPGDPLV 27 +LS SCSPGDPLV Sbjct: 6 KLSNSCSPGDPLV 18 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 65 RLSGSCSPGDPLV 27 R+S SCSPGDPLV Sbjct: 31 RVSNSCSPGDPLV 43 >SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 28.7 bits (61), Expect = 4.2 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -3 Query: 68 DRLSGSCSPGDPLV 27 +++S SCSPGDPLV Sbjct: 150 EKISNSCSPGDPLV 163 >SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 28.7 bits (61), Expect = 4.2 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 71 RDRLSGSCSPGDPLV 27 R R S SCSPGDPLV Sbjct: 3 RRRRSNSCSPGDPLV 17 >SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 28.7 bits (61), Expect = 4.2 Identities = 24/76 (31%), Positives = 31/76 (40%), Gaps = 10/76 (13%) Frame = -3 Query: 224 DAVLQAVKLPAGITDLDSGLANVYRDALTHFDSTSFSMLKCRIKL*SVVVQRDRL----- 60 D V+Q++ TDL + YR H L CR + +V+Q Sbjct: 125 DLVIQSLSYRPCCTDLVIQTLSSYRPC--HHTDLVMQTLSCRPRHTDLVIQTSSYRPCYT 182 Query: 59 -----SGSCSPGDPLV 27 S SCSPGDPLV Sbjct: 183 DLVIQSNSCSPGDPLV 198 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 65 RLSGSCSPGDPLV 27 R+S SCSPGDPLV Sbjct: 3 RVSNSCSPGDPLV 15 >SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 28.7 bits (61), Expect = 4.2 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = -3 Query: 113 MLKCRIKL*SVVVQRDRLSGSCSPGDPLV 27 ML+ +IKL ++ S SCSPGDPLV Sbjct: 12 MLRAKIKLFNI----GHRSNSCSPGDPLV 36 >SB_29960| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 65 RLSGSCSPGDPLV 27 +LS SCSPGDPLV Sbjct: 1 KLSNSCSPGDPLV 13 >SB_22214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 28.7 bits (61), Expect = 4.2 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 71 RDRLSGSCSPGDPLV 27 R R S SCSPGDPLV Sbjct: 23 RSRGSNSCSPGDPLV 37 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 65 RLSGSCSPGDPLV 27 R+S SCSPGDPLV Sbjct: 8 RVSNSCSPGDPLV 20 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 28.3 bits (60), Expect = 5.6 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -3 Query: 143 LTHFDSTSFSMLKCRIKL*SVVVQRDRLSGSCSPGDPLV 27 + HF T ++ I L + + +S SCSPGDPLV Sbjct: 1 MKHFTDT---LISANIPLRNPNTRAHLVSNSCSPGDPLV 36 >SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2070 Score = 28.3 bits (60), Expect = 5.6 Identities = 18/35 (51%), Positives = 21/35 (60%) Frame = -3 Query: 131 DSTSFSMLKCRIKL*SVVVQRDRLSGSCSPGDPLV 27 DS + S K I+ +VV LS SCSPGDPLV Sbjct: 494 DSPATSSYKDIIESTHIVVTF--LSNSCSPGDPLV 526 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 28.3 bits (60), Expect = 5.6 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 8/49 (16%) Frame = -3 Query: 149 DALTHFDSTSFSMLKCRIKL*SVVVQRDRL--------SGSCSPGDPLV 27 D + D TSF++ ++ V+ + D+ S SCSPGDPLV Sbjct: 26 DGIDKLDDTSFALYLSKMTRGKVLERLDKKLRNKHTNPSNSCSPGDPLV 74 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -3 Query: 80 VVQRDRLSGSCSPGDPLV 27 +++ LS SCSPGDPLV Sbjct: 58 ILEVQPLSNSCSPGDPLV 75 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -3 Query: 80 VVQRDRLSGSCSPGDPLV 27 ++ + LS SCSPGDPLV Sbjct: 8 LISANILSNSCSPGDPLV 25 >SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 28.3 bits (60), Expect = 5.6 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 71 RDRLSGSCSPGDPLV 27 R LS SCSPGDPLV Sbjct: 20 RLELSNSCSPGDPLV 34 >SB_34277| Best HMM Match : DUF321 (HMM E-Value=0.028) Length = 302 Score = 28.3 bits (60), Expect = 5.6 Identities = 12/37 (32%), Positives = 16/37 (43%) Frame = +3 Query: 366 GPHWHIQTVVSSRTTYYW*GRCGQQLCPWSLHHWKGN 476 G HW+ T + +W G G + W HW GN Sbjct: 48 GKHWYGNTGTKTLIWKHWYGNTGTKTLIWK--HWYGN 82 >SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 28.3 bits (60), Expect = 5.6 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 71 RDRLSGSCSPGDPLV 27 R LS SCSPGDPLV Sbjct: 13 RPVLSNSCSPGDPLV 27 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 28.3 bits (60), Expect = 5.6 Identities = 9/20 (45%), Positives = 16/20 (80%) Frame = +2 Query: 26 KLVDPPGCRSHLTGRAERRL 85 +LVDPPGCR+ ++ +R++ Sbjct: 658 ELVDPPGCRNSISSSNQRKI 677 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -3 Query: 83 VVVQRDRLSGSCSPGDPLV 27 ++V +S SCSPGDPLV Sbjct: 52 LIVVPSSISNSCSPGDPLV 70 >SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 28.3 bits (60), Expect = 5.6 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = +1 Query: 28 TSGSPGLQEPLNRSR*TTTDYNLILHLSIEKEV 126 TSGSPGLQE + R DY +I+ + K V Sbjct: 57 TSGSPGLQE-FDTCRDLHNDYTIIVDFGVGKPV 88 >SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -3 Query: 74 QRDRLSGSCSPGDPLV 27 Q+ S SCSPGDPLV Sbjct: 28 QKKNASNSCSPGDPLV 43 >SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 28.3 bits (60), Expect = 5.6 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -3 Query: 77 VQRDRLSGSCSPGDPLV 27 V R S SCSPGDPLV Sbjct: 5 VTMPRASNSCSPGDPLV 21 >SB_1004| Best HMM Match : CPSase_sm_chain (HMM E-Value=0) Length = 2007 Score = 28.3 bits (60), Expect = 5.6 Identities = 18/45 (40%), Positives = 26/45 (57%) Frame = +2 Query: 488 FWTESASSLTSVPVCKDS*SSTPSVEVPALGSLPY*WSVSPLTTA 622 FW+ S+SS T VP +T + VP++G Y VSP+T+A Sbjct: 165 FWSSSSSSPT-VPN-----KTTNGISVPSVGRSSYSTRVSPITSA 203 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 68 DRLSGSCSPGDPLV 27 D +S SCSPGDPLV Sbjct: 1 DPVSNSCSPGDPLV 14 >SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 28.3 bits (60), Expect = 5.6 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = -3 Query: 143 LTHFDSTSFSMLKCRIKL*SVVVQRDRLSGSCSPGDPLV 27 + HF T ++ I+ V+ R S SCSPGDPLV Sbjct: 1 MKHFTDT---LISANIEKRFRVIIAVRRSNSCSPGDPLV 36 >SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -3 Query: 83 VVVQRDRLSGSCSPGDPLV 27 V +++ S SCSPGDPLV Sbjct: 6 VSIKQQATSNSCSPGDPLV 24 >SB_39410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 68 DRLSGSCSPGDPLV 27 + LS SCSPGDPLV Sbjct: 22 NNLSNSCSPGDPLV 35 >SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -3 Query: 83 VVVQRDRLSGSCSPGDPLV 27 VV R S SCSPGDPLV Sbjct: 52 VVGMLPRRSNSCSPGDPLV 70 >SB_30190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 28.3 bits (60), Expect = 5.6 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = -3 Query: 143 LTHFDSTSFSMLKCRIK-L*SVVVQRDRLSGSCSPGDPLV 27 + HF T S IK L + V+ + S SCSPGDPLV Sbjct: 1 MKHFTDTLISA-NISIKILQELKVEVQKGSNSCSPGDPLV 39 >SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) Length = 181 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -3 Query: 80 VVQRDRLSGSCSPGDPLV 27 +++ R S SCSPGDPLV Sbjct: 65 MIENRRGSNSCSPGDPLV 82 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 34 LSNSCSPGDPLV 45 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 2 LSNSCSPGDPLV 13 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 27.9 bits (59), Expect = 7.4 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 65 RLSGSCSPGDPLV 27 ++S SCSPGDPLV Sbjct: 100 KISNSCSPGDPLV 112 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 65 RLSGSCSPGDPLV 27 R S SCSPGDPLV Sbjct: 22 RASNSCSPGDPLV 34 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 162 LSNSCSPGDPLV 173 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 93 LSNSCSPGDPLV 104 >SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 35 LSNSCSPGDPLV 46 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 13 LSNSCSPGDPLV 24 >SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 15 LSNSCSPGDPLV 26 >SB_24904| Best HMM Match : Op_neuropeptide (HMM E-Value=1.4) Length = 507 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/45 (28%), Positives = 23/45 (51%), Gaps = 3/45 (6%) Frame = +3 Query: 450 WSLHHWKG---NRRFGFGQNPQAR*PVYRSARIPDLPLLRWRYRL 575 W+L HW +F G + + P++ S I +LP+ R+R+ Sbjct: 142 WALEHWSDLLVGMKFTIGTDHKPLVPLFTSKMIDELPVRIQRFRM 186 >SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) Length = 174 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 50 LSNSCSPGDPLV 61 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -3 Query: 80 VVQRDRLSGSCSPGDPLV 27 ++Q +S SCSPGDPLV Sbjct: 4 LIQIRGISNSCSPGDPLV 21 >SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 8 LSNSCSPGDPLV 19 >SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 17 LSNSCSPGDPLV 28 >SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 42 LSNSCSPGDPLV 53 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 56 LSNSCSPGDPLV 67 >SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 11 LSNSCSPGDPLV 22 >SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 2 LSNSCSPGDPLV 13 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 27.9 bits (59), Expect = 7.4 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 65 RLSGSCSPGDPLV 27 ++S SCSPGDPLV Sbjct: 50 KISNSCSPGDPLV 62 >SB_12847| Best HMM Match : Ocnus (HMM E-Value=9.5) Length = 172 Score = 27.9 bits (59), Expect = 7.4 Identities = 15/62 (24%), Positives = 31/62 (50%), Gaps = 1/62 (1%) Frame = -3 Query: 305 SGLAEESVERIVSTPDGLVCGHLAIRLDAVLQAVKLPAGITD-LDSGLANVYRDALTHFD 129 SG+ ++++ R V T G + G ++ + +PA I + + S +Y+ + H D Sbjct: 40 SGITKQALMRSVKTTGGSMRGQEMTETQRLMWFISMPAEINNTMQSLTGTIYKTSEQHKD 99 Query: 128 ST 123 +T Sbjct: 100 TT 101 >SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 11 LSNSCSPGDPLV 22 >SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 34 LSNSCSPGDPLV 45 >SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 4 LSNSCSPGDPLV 15 >SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 78 LSNSCSPGDPLV 89 >SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 3 LSNSCSPGDPLV 14 >SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 35 LSNSCSPGDPLV 46 >SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 12 LSNSCSPGDPLV 23 >SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 65 RLSGSCSPGDPLV 27 R S SCSPGDPLV Sbjct: 6 RTSNSCSPGDPLV 18 >SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 11 LSNSCSPGDPLV 22 >SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 4 LSNSCSPGDPLV 15 >SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 23 LSNSCSPGDPLV 34 >SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 6 LSNSCSPGDPLV 17 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 55 LSNSCSPGDPLV 66 >SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 38 LSNSCSPGDPLV 49 >SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 24 LSNSCSPGDPLV 35 >SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 27.9 bits (59), Expect = 7.4 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = -3 Query: 113 MLKCRIKL*SVVVQRDRLSGSCSPGDPLV 27 +L+ R L S ++ R S SCSPGDPLV Sbjct: 48 ILRSRAILRSRAIRLSR-SNSCSPGDPLV 75 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 3 LSNSCSPGDPLV 14 >SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 65 RLSGSCSPGDPLV 27 R S SCSPGDPLV Sbjct: 13 RASNSCSPGDPLV 25 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 7 LSNSCSPGDPLV 18 >SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 56 LSNSCSPGDPLV 67 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 66 LSNSCSPGDPLV 77 >SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 71 RDRLSGSCSPGDPLV 27 R + S SCSPGDPLV Sbjct: 41 RKKRSNSCSPGDPLV 55 >SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) Length = 736 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 612 LSNSCSPGDPLV 623 >SB_40987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 68 DRLSGSCSPGDPLV 27 D S SCSPGDPLV Sbjct: 50 DTTSNSCSPGDPLV 63 >SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 71 RDRLSGSCSPGDPLV 27 +D S SCSPGDPLV Sbjct: 44 KDIASNSCSPGDPLV 58 >SB_39409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 61 LSNSCSPGDPLV 72 >SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 46 LSNSCSPGDPLV 57 >SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 47 LSNSCSPGDPLV 58 >SB_37019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 5 LSNSCSPGDPLV 16 >SB_36738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 71 RDRLSGSCSPGDPLV 27 + R S SCSPGDPLV Sbjct: 3 KKRSSNSCSPGDPLV 17 >SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 65 RLSGSCSPGDPLV 27 R S SCSPGDPLV Sbjct: 10 RTSNSCSPGDPLV 22 >SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 13 LSNSCSPGDPLV 24 >SB_33340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 8 LSNSCSPGDPLV 19 >SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 85 LSNSCSPGDPLV 96 >SB_30632| Best HMM Match : Acyltransferase (HMM E-Value=0.0097) Length = 263 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 15 LSNSCSPGDPLV 26 >SB_30140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 10 LSNSCSPGDPLV 21 >SB_29661| Best HMM Match : DUF872 (HMM E-Value=8.6) Length = 345 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 221 LSNSCSPGDPLV 232 >SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 37 LSNSCSPGDPLV 48 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -3 Query: 80 VVQRDRLSGSCSPGDPLV 27 +V + +S SCSPGDPLV Sbjct: 24 IVTKFGVSNSCSPGDPLV 41 >SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 71 RDRLSGSCSPGDPLV 27 R+ S SCSPGDPLV Sbjct: 4 RNERSNSCSPGDPLV 18 >SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 402 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 171 LSNSCSPGDPLV 182 >SB_22083| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 19 LSNSCSPGDPLV 30 >SB_21616| Best HMM Match : RVT_1 (HMM E-Value=0.00011) Length = 1380 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/45 (28%), Positives = 23/45 (51%), Gaps = 3/45 (6%) Frame = +3 Query: 450 WSLHHWKG---NRRFGFGQNPQAR*PVYRSARIPDLPLLRWRYRL 575 W+L HW +F G + + P++ S I +LP+ R+R+ Sbjct: 763 WALEHWSDLLVGMKFTIGTDHKPLVPLFTSKMIDELPVRIQRFRM 807 >SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 65 RLSGSCSPGDPLV 27 R S SCSPGDPLV Sbjct: 9 RASNSCSPGDPLV 21 >SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 65 RLSGSCSPGDPLV 27 R S SCSPGDPLV Sbjct: 18 RASNSCSPGDPLV 30 >SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 105 LSNSCSPGDPLV 116 >SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 2 LSNSCSPGDPLV 13 >SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 63 LSNSCSPGDPLV 74 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -3 Query: 86 SVVVQRDRLSGSCSPGDPLV 27 S + ++S SCSPGDPLV Sbjct: 10 SANIANAKVSNSCSPGDPLV 29 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 8 LSNSCSPGDPLV 19 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 27.9 bits (59), Expect = 7.4 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = +2 Query: 26 KLVDPPGCRSHLTGR 70 +LVDPPGCR+ + G+ Sbjct: 90 ELVDPPGCRNSIAGK 104 >SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 13 LSNSCSPGDPLV 24 >SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 27.9 bits (59), Expect = 7.4 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 65 RLSGSCSPGDPLV 27 ++S SCSPGDPLV Sbjct: 5 KISNSCSPGDPLV 17 >SB_9035| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 36 LSNSCSPGDPLV 47 >SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 33 LSNSCSPGDPLV 44 >SB_7708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 65 RLSGSCSPGDPLV 27 R S SCSPGDPLV Sbjct: 4 RASNSCSPGDPLV 16 >SB_4628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 18 LSNSCSPGDPLV 29 >SB_2728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 62 LSGSCSPGDPLV 27 LS SCSPGDPLV Sbjct: 29 LSNSCSPGDPLV 40 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -3 Query: 77 VQRDRLSGSCSPGDPLV 27 ++R S SCSPGDPLV Sbjct: 92 IKRALASNSCSPGDPLV 108 >SB_719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 293 Score = 27.9 bits (59), Expect = 7.4 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -3 Query: 137 HFDSTSFSMLKCRIKL*SVVVQRDRLSGSCSPGDPLV 27 H D S L+ + + +++ S SCSPGDPLV Sbjct: 144 HGDKPSVHGLESNCAARTKPLTQEKGSNSCSPGDPLV 180 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 65 RLSGSCSPGDPLV 27 ++S SCSPGDPLV Sbjct: 4 QISNSCSPGDPLV 16 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 26 KLVDPPGCRSHLTGRAER 79 +LVDPPGCR+ + G R Sbjct: 14 ELVDPPGCRNSMIGSGGR 31 >SB_50612| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26) Length = 904 Score = 27.5 bits (58), Expect = 9.7 Identities = 19/64 (29%), Positives = 28/64 (43%), Gaps = 2/64 (3%) Frame = +3 Query: 138 RECISVHVGQAGVQIGNACWELYCLEHGIQPDG-QMPTDKT-IGGGDDSFNTFFSETGAG 311 + C S + +GV+ G W L + GIQP P+D + D +NT + Sbjct: 237 KPCASKKILASGVRYGKLTWTLGAMTSGIQPSTVSAPSDDSDCNVLCDQYNTVLNHF-IE 295 Query: 312 KHVP 323 KH P Sbjct: 296 KHAP 299 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 65 RLSGSCSPGDPLV 27 ++S SCSPGDPLV Sbjct: 15 QISNSCSPGDPLV 27 >SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 65 RLSGSCSPGDPLV 27 R S SCSPGDPLV Sbjct: 2 RRSNSCSPGDPLV 14 >SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 65 RLSGSCSPGDPLV 27 R S SCSPGDPLV Sbjct: 21 RKSNSCSPGDPLV 33 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 65 RLSGSCSPGDPLV 27 ++S SCSPGDPLV Sbjct: 33 KVSNSCSPGDPLV 45 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -3 Query: 77 VQRDRLSGSCSPGDPLV 27 ++ +S SCSPGDPLV Sbjct: 1061 LEEKEVSNSCSPGDPLV 1077 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 27.5 bits (58), Expect = 9.7 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = -1 Query: 571 RYLHRRSGRSGILADRYTGQRACGFCPKPNLRFPF 467 RY H + +T +R C F P N+ FPF Sbjct: 426 RYGHEHDTNTSRYEHEHTTKRMCSFRPGSNVVFPF 460 >SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 27.5 bits (58), Expect = 9.7 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = -3 Query: 86 SVVVQRDRLSGSCSPGDPLV 27 S VVQ+ S SCSPGDPLV Sbjct: 66 SCVVQK---SNSCSPGDPLV 82 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 65 RLSGSCSPGDPLV 27 ++S SCSPGDPLV Sbjct: 2 KVSNSCSPGDPLV 14 >SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 65 RLSGSCSPGDPLV 27 R S SCSPGDPLV Sbjct: 23 RQSNSCSPGDPLV 35 >SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -3 Query: 77 VQRDRLSGSCSPGDPLV 27 + + + S SCSPGDPLV Sbjct: 21 LSKSKRSNSCSPGDPLV 37 >SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 65 RLSGSCSPGDPLV 27 ++S SCSPGDPLV Sbjct: 20 QISNSCSPGDPLV 32 >SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 65 RLSGSCSPGDPLV 27 ++S SCSPGDPLV Sbjct: 3 QISNSCSPGDPLV 15 >SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 68 DRLSGSCSPGDPLV 27 + +S SCSPGDPLV Sbjct: 2 EHVSNSCSPGDPLV 15 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -3 Query: 80 VVQRDRLSGSCSPGDPLV 27 ++ + +S SCSPGDPLV Sbjct: 8 LISANIISNSCSPGDPLV 25 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 27.5 bits (58), Expect = 9.7 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +2 Query: 26 KLVDPPGCRSHLTGRAER 79 +LVDPPGCR+ + + E+ Sbjct: 14 ELVDPPGCRNSIKDKGEK 31 >SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.5 bits (58), Expect = 9.7 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -3 Query: 77 VQRDRLSGSCSPGDPLV 27 V+R R S SCSPGDPLV Sbjct: 6 VKRTR-SNSCSPGDPLV 21 >SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 68 DRLSGSCSPGDPLV 27 + +S SCSPGDPLV Sbjct: 39 ENVSNSCSPGDPLV 52 >SB_36996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 65 RLSGSCSPGDPLV 27 R S SCSPGDPLV Sbjct: 2 RKSNSCSPGDPLV 14 >SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -3 Query: 74 QRDRLSGSCSPGDPLV 27 +R S SCSPGDPLV Sbjct: 13 KRPHRSNSCSPGDPLV 28 >SB_34798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -3 Query: 74 QRDRLSGSCSPGDPLV 27 Q + S SCSPGDPLV Sbjct: 9 QLKKASNSCSPGDPLV 24 >SB_33964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 416 Score = 27.5 bits (58), Expect = 9.7 Identities = 18/52 (34%), Positives = 24/52 (46%) Frame = +1 Query: 295 ARPELASTYPGAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYAR 450 AR S Y G DL+ + D R+ Y HP+Q K +ANN+ R Sbjct: 349 ARNNTLSHYTGFELHDLQTCIQDLHRSFAYAPN-HPQQATREKYRSANNFNR 399 >SB_32543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 68 DRLSGSCSPGDPLV 27 D S SCSPGDPLV Sbjct: 73 DNPSNSCSPGDPLV 86 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 65 RLSGSCSPGDPLV 27 ++S SCSPGDPLV Sbjct: 17 KVSNSCSPGDPLV 29 >SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 65 RLSGSCSPGDPLV 27 R S SCSPGDPLV Sbjct: 59 RRSNSCSPGDPLV 71 >SB_30165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 9.7 Identities = 13/18 (72%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Frame = -3 Query: 77 VQRDRL-SGSCSPGDPLV 27 VQR + S SCSPGDPLV Sbjct: 2 VQRHNVTSNSCSPGDPLV 19 >SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.5 bits (58), Expect = 9.7 Identities = 14/23 (60%), Positives = 16/23 (69%), Gaps = 3/23 (13%) Frame = -3 Query: 86 SVVVQRDRL---SGSCSPGDPLV 27 +V+V R R S SCSPGDPLV Sbjct: 13 AVIVVRSRKTISSNSCSPGDPLV 35 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 27.5 bits (58), Expect = 9.7 Identities = 13/21 (61%), Positives = 16/21 (76%), Gaps = 1/21 (4%) Frame = -3 Query: 86 SVVVQRDRL-SGSCSPGDPLV 27 +++ R RL S SCSPGDPLV Sbjct: 18 AILSPRARLVSNSCSPGDPLV 38 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 65 RLSGSCSPGDPLV 27 ++S SCSPGDPLV Sbjct: 16 KVSNSCSPGDPLV 28 >SB_21711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -3 Query: 83 VVVQRDRLSGSCSPGDPLV 27 V++ ++ S SCSPGDPLV Sbjct: 38 VLLVANKPSNSCSPGDPLV 56 >SB_15081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -3 Query: 71 RDRLSGSCSPGDPLV 27 R S SCSPGDPLV Sbjct: 12 RSTASNSCSPGDPLV 26 >SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 65 RLSGSCSPGDPLV 27 R S SCSPGDPLV Sbjct: 2 RRSNSCSPGDPLV 14 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 27.5 bits (58), Expect = 9.7 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -3 Query: 143 LTHFDSTSFSMLKCRIKL*SVVVQRDRLSGSCSPGDPLV 27 + HF T S ++ V + +S SCSPGDPLV Sbjct: 1 MKHFTDTLISANIVFLREFVYTVIQKVVSNSCSPGDPLV 39 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -3 Query: 80 VVQRDRLSGSCSPGDPLV 27 ++ + +S SCSPGDPLV Sbjct: 8 LISANIISNSCSPGDPLV 25 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,553,968 Number of Sequences: 59808 Number of extensions: 472702 Number of successful extensions: 2688 Number of sequences better than 10.0: 226 Number of HSP's better than 10.0 without gapping: 2566 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2682 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1608851125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -