BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0306 (382 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 25 0.40 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 21 3.7 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 24.6 bits (51), Expect = 0.40 Identities = 10/36 (27%), Positives = 23/36 (63%) Frame = -2 Query: 285 KENIFILYKVCPLNLNVIAGFLIKVVYVTLQSIILL 178 ++N+ +++ + + + +I GFL ++ T QSI L+ Sbjct: 61 RKNMLLVFTIAAVLVGLILGFLGRLANPTPQSITLI 96 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 21.4 bits (43), Expect = 3.7 Identities = 8/26 (30%), Positives = 11/26 (42%) Frame = +2 Query: 53 CPWPPCLHEQR*SMCCCVTFKDNKTC 130 C W + + C V F +NK C Sbjct: 70 CTWTITSYHRINLKCSLVEFSENKNC 95 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,137 Number of Sequences: 438 Number of extensions: 1858 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 9300375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -