BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0304 (637 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. 25 2.7 AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein... 25 2.7 AJ970250-1|CAI96722.1| 132|Anopheles gambiae putative reverse t... 24 3.5 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 6.1 AY645021-1|AAT92557.1| 163|Anopheles gambiae even-skipped protein. 23 8.1 >AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. Length = 458 Score = 24.6 bits (51), Expect = 2.7 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +2 Query: 8 AAGIRHEVLLVYMDFISVSPQQNWLHRVLC 97 + GI E + Y D++S P + +V+C Sbjct: 363 SCGIAEEYKVPYFDYVSSDPSFEEMRKVVC 392 >AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein coupled receptor protein. Length = 695 Score = 24.6 bits (51), Expect = 2.7 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 64 TSAKLATSGVVLLCYSSLGTLVLQLELIVC 153 + A L T + LLC S+ G+ V+ VC Sbjct: 594 SQANLCTDTIPLLCASNSGSTVISPNATVC 623 >AJ970250-1|CAI96722.1| 132|Anopheles gambiae putative reverse transcriptase protein. Length = 132 Score = 24.2 bits (50), Expect = 3.5 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = +3 Query: 180 LPLEILLMVFNSIAFQNTIFTWVRDHRLHHKY 275 LP ILL N + F ++ W++ + ++ Y Sbjct: 79 LPHAILLAKLNKVRFPCSLVQWLKSYLINRTY 110 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.4 bits (48), Expect = 6.1 Identities = 8/32 (25%), Positives = 16/32 (50%) Frame = +3 Query: 180 LPLEILLMVFNSIAFQNTIFTWVRDHRLHHKY 275 LP ILL + + + + W++ + +H Y Sbjct: 694 LPHAILLAKLDKLGIPSPLVQWLKSYLIHRTY 725 >AY645021-1|AAT92557.1| 163|Anopheles gambiae even-skipped protein. Length = 163 Score = 23.0 bits (47), Expect = 8.1 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +3 Query: 225 QNTIFTWVRDHRLHHKYTDTDADPHNA 305 Q+T+ T H+LHH+ A PH+A Sbjct: 63 QDTVGT--AQHQLHHQGHSPVASPHSA 87 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 714,881 Number of Sequences: 2352 Number of extensions: 15653 Number of successful extensions: 20 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62305095 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -