BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0303 (488 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U40800-9|AAA81494.1| 316|Caenorhabditis elegans Hypothetical pr... 47 8e-06 L13200-4|AAA28191.2| 645|Caenorhabditis elegans Hypothetical pr... 29 1.8 Z81123-2|CAB03365.1| 734|Caenorhabditis elegans Hypothetical pr... 29 2.4 >U40800-9|AAA81494.1| 316|Caenorhabditis elegans Hypothetical protein D2096.8 protein. Length = 316 Score = 46.8 bits (106), Expect = 8e-06 Identities = 25/82 (30%), Positives = 40/82 (48%) Frame = +2 Query: 209 EAMASLPPNVRRRIRALRTLQKEFVDIEAKFYSEVHAXXXXXXXXXXXXXXXRALIVNGT 388 + + +LP NV++R+ AL+ LQ + + IE+ FY VH R IV G Sbjct: 17 DMIQALPLNVKQRVCALKNLQMKTIQIESDFYKRVHELEIEFEGKFKSTFDQRKAIVAGE 76 Query: 389 YEPNDDECLNPWRDDTEEEELA 454 EP ++ P + E ++LA Sbjct: 77 VEPTKEQIDTPILEGLEGDQLA 98 >L13200-4|AAA28191.2| 645|Caenorhabditis elegans Hypothetical protein ZK1236.1 protein. Length = 645 Score = 29.1 bits (62), Expect = 1.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 322 ECMYFTVKLGLNVDKLLLKSSQGADSPTNI 233 EC++ + K GLNVDK+L +PT I Sbjct: 188 ECLHISAKSGLNVDKVLEAIIDRVPAPTAI 217 >Z81123-2|CAB03365.1| 734|Caenorhabditis elegans Hypothetical protein T14D7.2 protein. Length = 734 Score = 28.7 bits (61), Expect = 2.4 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 3/64 (4%) Frame = -2 Query: 445 FFFSVITPWVETFIIIRFICAIHNKSSLFIKRLVKFFI---FAFECMYFTVKLGLNVDKL 275 + F +I P V T++++ F + + LFI V+ I FA C + LN+++L Sbjct: 648 YLFHMI-PVVLTYMLVPFPIYFNTQIPLFIHCFVQLLITYFFAIICTMVSELPALNIERL 706 Query: 274 LLKS 263 LL S Sbjct: 707 LLAS 710 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,717,204 Number of Sequences: 27780 Number of extensions: 203442 Number of successful extensions: 547 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 526 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 547 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 914086948 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -